Lus10015566 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64720 95 / 3e-23 CP5 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G54170 61 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G14500 55 / 6e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT3G23080 52 / 7e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032938 124 / 1e-33 AT1G64720 437 / 2e-152 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10033247 85 / 2e-19 AT1G64720 523 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008281 62 / 8e-12 AT1G64720 374 / 1e-130 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10041166 46 / 8e-06 AT4G14500 607 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10021883 45 / 1e-05 AT4G14500 605 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G450100 92 / 5e-22 AT1G64720 489 / 6e-173 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.012G021400 90 / 4e-21 AT1G64720 478 / 2e-168 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.011G151500 88 / 1e-20 AT1G64720 515 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.015G005000 88 / 2e-20 AT1G64720 474 / 1e-166 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G076500 51 / 8e-08 AT4G14500 571 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.008G162600 50 / 2e-07 AT4G14500 581 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10015566 pacid=23145919 polypeptide=Lus10015566 locus=Lus10015566.g ID=Lus10015566.BGIv1.0 annot-version=v1.0
ATGGGGATTCCATGGGAAATCTCGAAGCTCGGTATTCGACAGGGAATGTGGGCATCGGTCAAGAAGATCGAGCCAGGGCTACTTGCTTACCAAACGGCCA
GGGCATCATCTGATTCAGAAGCAGGAAGTTCCGAAGTTGAAAGCTCAGGAAGGAACTTATCAAAGGTTTTGATTATAGGTGCAGCTGTTGCCCTTGCATG
CAGTATCGACCAGGGGCTAGTGGGTAAAGCTTGTATTTTTGGGATAGCTAGAAGGTTAGGGAGTTTCAGGAAGAGATCTGTAAACCCCATTGCATTAGCT
GATGATGATAGTGAAGACAACATAACCTTGGCAGAAGTGAAGCGTACCAAACACCAGCTGATGCCCTCTCAGAATAAACCTCCAACTTGGGTTGCTTCCC
CACTTGTGAAAGTGAAACAAGAACGTTTTGCTGACAATTCAACATCAGCAGTCCCCAACGACAAACCTTCTCCGGCGCAAAAAACTCCAGCTGGGCGCAT
TCCGCAGAACCCATCTCACCAAACCGAGCAGCCCATCAAGACTGCTCAAAAACGCCTTTTCCCTGTCTAG
AA sequence
>Lus10015566 pacid=23145919 polypeptide=Lus10015566 locus=Lus10015566.g ID=Lus10015566.BGIv1.0 annot-version=v1.0
MGIPWEISKLGIRQGMWASVKKIEPGLLAYQTARASSDSEAGSSEVESSGRNLSKVLIIGAAVALACSIDQGLVGKACIFGIARRLGSFRKRSVNPIALA
DDDSEDNITLAEVKRTKHQLMPSQNKPPTWVASPLVKVKQERFADNSTSAVPNDKPSPAQKTPAGRIPQNPSHQTEQPIKTAQKRLFPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10015566 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 3.2 1.0000
Lus10001326 6.5 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 7.3 1.0000
Lus10014857 8.9 1.0000
Lus10026755 9.2 1.0000
Lus10009206 11.0 1.0000
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 11.2 1.0000
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10008511 12.4 1.0000
Lus10016593 13.1 1.0000
AT2G43610 Chitinase family protein (.1) Lus10020253 14.8 1.0000

Lus10015566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.