Lus10015575 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015575 pacid=23145920 polypeptide=Lus10015575 locus=Lus10015575.g ID=Lus10015575.BGIv1.0 annot-version=v1.0
ATGAGAGAAATTTACAAGCTATTTGGCCATAACGATAGCAGTGATCCTCGCGGTGTTATGGGAGTTACACGTGTTGGATGTGCCATAATCTCTGCGTTAA
TCTGGATACTTGTCTTTAGAATCCCATATGAAGAGATAGCGCTATACGTCCTAATATTCCTCCAACAAAAGGATTCAGAGTACGCTTGCAATATACTCTA
CATACTCCTTAGAGCTGCAGCACTTGGTTTGACCTATGCGGTTTACAAATTCGGCCAAGGAGTTGAAGCAGGCACCTACAGACTTGGACACCTCGGGAGA
CTCGTGGACTACGCGGCCTTTGCACTGATTACAGCGATTCTGGCGTCGAGCATGGGAGGGGGCCGTGATAGGTATCAGCTTAGAGTTCCATTGTCTGATG
AAGTTGGGATGGAACTTGCTGGACTACACTTTTATGGATATGATGATGATTGA
AA sequence
>Lus10015575 pacid=23145920 polypeptide=Lus10015575 locus=Lus10015575.g ID=Lus10015575.BGIv1.0 annot-version=v1.0
MREIYKLFGHNDSSDPRGVMGVTRVGCAIISALIWILVFRIPYEEIALYVLIFLQQKDSEYACNILYILLRAAALGLTYAVYKFGQGVEAGTYRLGHLGR
LVDYAAFALITAILASSMGGGRDRYQLRVPLSDEVGMELAGLHFYGYDDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015575 0 1
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10022378 6.4 0.7211
AT1G63250 DEA(D/H)-box RNA helicase fami... Lus10034440 9.2 0.6721
AT5G16420 Pentatricopeptide repeat (PPR-... Lus10005989 19.9 0.6492
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10024161 20.4 0.6989
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10038396 27.0 0.6783
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Lus10006181 30.9 0.6757
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10028836 31.9 0.6422
AT2G41080 Tetratricopeptide repeat (TPR)... Lus10003324 36.0 0.6673
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10024943 36.6 0.6628
AT5G08305 Pentatricopeptide repeat (PPR)... Lus10010183 46.8 0.6424

Lus10015575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.