Lus10015577 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042586 64 / 1e-13 ND /
Lus10011725 55 / 5e-10 ND /
Lus10024524 44 / 5e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015577 pacid=23145893 polypeptide=Lus10015577 locus=Lus10015577.g ID=Lus10015577.BGIv1.0 annot-version=v1.0
ATGGTAGCCAAACCTCATGGTCATGAGGTCAAAACTCCAGATTTATCGAAGGCGACGACCTCTAAACAACAGGCTAAGTATCTCAAGCTTTTACCTTTGA
TTTTTCATACCTATATTACTATGGATGACACATCAATAGCTGTCTCTAAAGTCGACGAGGGTGCTTCCTCCATATCTAATCATCAGTCGATGGTTGAGGA
TGTTGTAACTCCACCTTGTGTGGATTTACTATCATCTGATTCTCAACCTGGCTCTTTCCCTTTTCCAGGTTTACCGAACATGTCTCTCACTAACTGGAAA
CGTCCTCGTGAGGTGAATACAAAAGGTGATGATGGTGGAGTAGACTCTTCCTCTACCTAG
AA sequence
>Lus10015577 pacid=23145893 polypeptide=Lus10015577 locus=Lus10015577.g ID=Lus10015577.BGIv1.0 annot-version=v1.0
MVAKPHGHEVKTPDLSKATTSKQQAKYLKLLPLIFHTYITMDDTSIAVSKVDEGASSISNHQSMVEDVVTPPCVDLLSSDSQPGSFPFPGLPNMSLTNWK
RPREVNTKGDDGGVDSSST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015577 0 1
Lus10022574 1.4 0.8198
AT3G26270 CYP71B25 "cytochrome P450, family 71, s... Lus10028112 15.8 0.7199
AT2G23140 RING/U-box superfamily protein... Lus10019306 22.2 0.6331
AT4G36210 Protein of unknown function (D... Lus10010626 23.0 0.6719
AT1G10710 PHS1 poor homologous synapsis 1 (.1... Lus10042079 24.3 0.6678
Lus10000768 25.1 0.6983
AT4G20050 QRT3 QUARTET 3, Pectin lyase-like s... Lus10036231 25.3 0.6663
AT1G65680 ATHEXPBETA1.4, ... expansin B2 (.1) Lus10027223 27.5 0.7110
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Lus10033519 28.1 0.6972
AT5G16990 Zinc-binding dehydrogenase fam... Lus10030086 30.0 0.6464

Lus10015577 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.