Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G004700 [exp] 77 / 7e-18 AT5G24630 214 / 3e-65 MIDGET, brassinosteroid-insensitive4, double-stranded DNA binding (.1.2.3.4.5.6)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015592 pacid=23145902 polypeptide=Lus10015592 locus=Lus10015592.g ID=Lus10015592.BGIv1.0 annot-version=v1.0 ATGGTACAAGATAACACTACTGGAAACAGTGACGTCTACTTCGACTTGAAAGGAACACTGGAGGGTTTCTCATTCGACTCAGAAGACGAAGCAGAAAAAG TCCCTAAACATATCAATCAGAAAAATCAGAATGAGGGGCTAGAAGAACAGCCCAATGGTCGTAAAACTAAGGGAAAAGCAGAGAAGGCATCGGGCGTCAT TAAGAAGAAAAACAAGAATGCAGGAGGGAAGTCTCATCCGGTGAAGCGCGGGGCAAAGAAAATGCAGCCTCCTAAGAGAGGGAAAGCTAAGAAATAG
AA sequence Show only first row Show all	>Lus10015592 pacid=23145902 polypeptide=Lus10015592 locus=Lus10015592.g ID=Lus10015592.BGIv1.0 annot-version=v1.0 MVQDNTTGNSDVYFDLKGTLEGFSFDSEDEAEKVPKHINQKNQNEGLEEQPNGRKTKGKAEKASGVIKKKNKNAGGKSHPVKRGAKKMQPPKRGKAKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015592 [exp]	0	1
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10032609 [exp]	1.7	0.9106
AT3G54170		ATFIP37	FKBP12 interacting protein 37 ...		Lus10027681 [exp]	2.8	0.9085
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Lus10039656 [exp]	5.9	0.8942
AT5G57230			Thioredoxin superfamily protei...		Lus10003582 [exp]	7.7	0.8967
AT2G21150		XCT	XAP5 CIRCADIAN TIMEKEEPER, XAP...		Lus10012170 [exp]	8.7	0.9032
AT5G62950			RNA polymerase II, Rpb4, core ...		Lus10039583 [exp]	8.7	0.8768
AT1G51730			Ubiquitin-conjugating enzyme f...		Lus10037613 [exp]	15.2	0.8828
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10025933 [exp]	19.9	0.8714
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031006 [exp]	22.1	0.8832
AT1G15200			protein-protein interaction re...		Lus10023800 [exp]	24.7	0.8856

Compare expression of checked genes

Lus10015592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.