Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24660 66 / 2e-15 LSU2 response to low sulfur 2 (.1) AT3G49570 63 / 2e-14 LSU3 response to low sulfur 3 (.1) AT5G24655 61 / 9e-14 LSU4 response to low sulfur 4 (.1) AT3G49580 58 / 2e-12 LSU1 response to low sulfur 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032912 [exp] 83 / 4e-22 AT5G24660 82 / 8e-22 response to low sulfur 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G004500 [exp] 67 / 4e-16 AT5G24660 81 / 2e-21 response to low sulfur 2 (.1) Potri.015G000500 [exp] 67 / 6e-16 AT5G24660 78 / 2e-20 response to low sulfur 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015594 pacid=23145928 polypeptide=Lus10015594 locus=Lus10015594.g ID=Lus10015594.BGIv1.0 annot-version=v1.0 ATGGCGGAACTACTGAGGAGGAGAAACGATGAGCTGGAGAGGGCGCTGAAGGAGAGCAGGGAGAGGGAGGAGATGATGAGGCAAGAGCTCGAGCTTGCGT GGCGGAGGATGCGAGTTGCGGAGGACGCTGAGGAGAGGCTCTGCTCTCAGCTCGGTGAATTAGAGGCGGAGGCCGTCAATCAAGCGCGTGATTATCACGC TCGGATGGTTTCGTTGATGGAGCAGCTTCAGCAAGCTCAGGGTCTCCTCCTCCTCCACTCTTCCTCCTCATCGTCTCTGGCCTCGTCATAA
AA sequence Show only first row Show all	>Lus10015594 pacid=23145928 polypeptide=Lus10015594 locus=Lus10015594.g ID=Lus10015594.BGIv1.0 annot-version=v1.0 MAELLRRRNDELERALKESREREEMMRQELELAWRRMRVAEDAEERLCSQLGELEAEAVNQARDYHARMVSLMEQLQQAQGLLLLHSSSSSSLASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24660		LSU2	response to low sulfur 2 (.1)		Lus10015594 [exp]	0	1
AT5G24660		LSU2	response to low sulfur 2 (.1)		Lus10032912 [exp]	1.0	0.8017
AT1G04770			Tetratricopeptide repeat (TPR)...		Lus10011738 [exp]	2.0	0.7988
AT1G65980		TPX1	thioredoxin-dependent peroxida...		Lus10023180 [exp]	3.2	0.7194
AT1G08630		THA1	threonine aldolase 1 (.1.2.3.4...		Lus10000556 [exp]	4.5	0.7282
AT4G04610		1-Apr, PRH19, A...	PAPS REDUCTASE HOMOLOG 19, APS...		Lus10020040 [exp]	21.8	0.7138
AT1G04770			Tetratricopeptide repeat (TPR)...		Lus10000753 [exp]	22.0	0.7417
AT1G07510		FTSH10	FTSH protease 10 (.1)		Lus10004972 [exp]	26.8	0.6529
AT3G57450			unknown protein		Lus10019730 [exp]	32.9	0.6322
AT4G10770		ATOPT7	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10028445 [exp]	50.2	0.6420
AT4G13040	AP2_ERF		Integrase-type DNA-binding sup...		Lus10022769 [exp]	50.7	0.6006

Compare expression of checked genes

Lus10015594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.