Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29660 149 / 1e-48 EMB2752 embryo defective 2752 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032908 [exp] 199 / 3e-68 AT4G29660 150 / 7e-49 embryo defective 2752 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G001800 [exp] 171 / 4e-57 AT4G29660 147 / 1e-47 embryo defective 2752 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015598 pacid=23145905 polypeptide=Lus10015598 locus=Lus10015598.g ID=Lus10015598.BGIv1.0 annot-version=v1.0 ATGGCGAGCTATCTATGGAGGAAATATGCAGATTATCTGTACACAAAATGGGAGAGGACGATTCTGTGGGATATGATTGATCCTTACAGAAGACCCAAAT CATTTACCCCTCTGGTCACTATCTACGTAGCTGCCTTCTACACTGGCGTCGTTGGAGCTGCCATCACCGAGCAGCGATACAAGGAGAAGTATTGGGAAGA TCATCCAGGGGAAACAGTGCCTCTCATGACGCCAAAGTATTATTCTGGTCCCTGGAGGGTATATAGAGGCGAAGCTGTGACACCAAACAATTAG
AA sequence Show only first row Show all	>Lus10015598 pacid=23145905 polypeptide=Lus10015598 locus=Lus10015598.g ID=Lus10015598.BGIv1.0 annot-version=v1.0 MASYLWRKYADYLYTKWERTILWDMIDPYRRPKSFTPLVTIYVAAFYTGVVGAAITEQRYKEKYWEDHPGETVPLMTPKYYSGPWRVYRGEAVTPNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29660		EMB2752	embryo defective 2752 (.1)		Lus10015598 [exp]	0	1
AT5G07670			RNI-like superfamily protein (...		Lus10027217 [exp]	5.5	0.8110
AT2G39630			Nucleotide-diphospho-sugar tra...		Lus10040296 [exp]	12.0	0.7618
AT5G42700	B3		AP2/B3-like transcriptional fa...		Lus10032748 [exp]	16.2	0.7333
AT5G08010			unknown protein		Lus10040520 [exp]	18.8	0.7639
AT5G11470			bromo-adjacent homology (BAH) ...		Lus10038628 [exp]	19.1	0.7634
AT5G61450			P-loop containing nucleoside t...		Lus10031163 [exp]	20.0	0.7544
AT5G59180		NRPB7	DNA-directed RNA polymerase II...		Lus10001559 [exp]	24.2	0.7421
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10019163 [exp]	28.2	0.7183
AT1G05785			Got1/Sft2-like vescicle transp...		Lus10019570 [exp]	29.4	0.7158
AT3G23580		RNR2A	ribonucleotide reductase 2A (....		Lus10004435 [exp]	29.8	0.7311

Compare expression of checked genes

Lus10015598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.