Lus10015603 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032902 197 / 2e-65 AT1G54400 89 / 4e-22 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G054900 59 / 3e-11 AT1G54400 97 / 3e-25 HSP20-like chaperones superfamily protein (.1)
Potri.013G054800 47 / 4e-07 AT1G54400 98 / 6e-26 HSP20-like chaperones superfamily protein (.1)
Potri.013G054700 43 / 2e-05 AT1G54400 93 / 3e-24 HSP20-like chaperones superfamily protein (.1)
Potri.004G191000 38 / 0.0006 AT2G27140 81 / 2e-19 HSP20-like chaperones superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10015603 pacid=23145899 polypeptide=Lus10015603 locus=Lus10015603.g ID=Lus10015603.BGIv1.0 annot-version=v1.0
ATGACGATAACAGGGGAACGGTGTCTGGACTCCGATCATAACGATCGATGTGCGCGATTTACAAAGGAGACACGTGTCCCCAACGAAATCAACACCACTG
CCATTCACGCCAAGCTCTCCTCCGGCATTCTTTCTATCTTCATGCCCAAGAATGCAACGTTGTTGCTTCCACAATCTCAGGAATCCGCTGATGGCGAACA
AAATCCGCCGCAGCAGGTTTCGGAGACAGAGCATGGGCAGCAGCATCAGAAACAAGACTCAAAACCAAACGTTGGAGATTCGAGCCATCAAAATGAGGAT
TGTCGGATGATGAAATTGAAAGATCCGGCGCCGGTGAGGGGGGAATTTGGAATCCTAGCTGTTGTTGTTGTTGTAATTGTGGCTGTGGGTGCGGTTCTGG
TGGGATATGGATTGAGAACCAGTTACTCAAATGCGTTGTGGGAAAAATAG
AA sequence
>Lus10015603 pacid=23145899 polypeptide=Lus10015603 locus=Lus10015603.g ID=Lus10015603.BGIv1.0 annot-version=v1.0
MTITGERCLDSDHNDRCARFTKETRVPNEINTTAIHAKLSSGILSIFMPKNATLLLPQSQESADGEQNPPQQVSETEHGQQHQKQDSKPNVGDSSHQNED
CRMMKLKDPAPVRGEFGILAVVVVVIVAVGAVLVGYGLRTSYSNALWEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015603 0 1
AT1G75260 oxidoreductases, acting on NAD... Lus10033210 9.3 0.9027
AT1G75260 oxidoreductases, acting on NAD... Lus10001963 9.9 0.8979
AT5G46530 AWPM-19-like family protein (.... Lus10011973 10.8 0.8939
Lus10015565 12.0 0.8899
AT3G26880 Plant self-incompatibility pro... Lus10038163 13.5 0.8889
Lus10016944 16.0 0.8960
AT1G75260 oxidoreductases, acting on NAD... Lus10010832 20.4 0.8923
AT1G07400 HSP20-like chaperones superfam... Lus10021503 21.6 0.8827
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10009445 24.0 0.8887
AT5G46530 AWPM-19-like family protein (.... Lus10004587 26.7 0.8873

Lus10015603 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.