Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015617 pacid=23147259 polypeptide=Lus10015617 locus=Lus10015617.g ID=Lus10015617.BGIv1.0 annot-version=v1.0 ATGGCGATAAAACCAACAGTGGCTTTCAGAGCTATACTCGTAGGAGGGATAGCAGTGTTTGCGAAAGTTGCAGGTGCAATGAAAGCTGCAGGTGGTGCAA AGCTTGGAGCTGCTGCAACCGCCATGACAGTTGCAGCTTCAGCAGCAATGTCAAGTCCCAAAGATGATAAAAAGGATTCTAAATGA
AA sequence Show only first row Show all	>Lus10015617 pacid=23147259 polypeptide=Lus10015617 locus=Lus10015617.g ID=Lus10015617.BGIv1.0 annot-version=v1.0 MAIKPTVAFRAILVGGIAVFAKVAGAMKAAGGAKLGAAATAMTVAASAAMSSPKDDKKDSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13845			unknown protein		Lus10015617 [exp]	0	1
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10019163 [exp]	1.0	0.8171
AT1G55805			BolA-like family protein (.1)		Lus10002318 [exp]	4.0	0.8167
AT2G22795			unknown protein		Lus10007239 [exp]	4.9	0.8141
AT5G04000			unknown protein		Lus10018038 [exp]	6.0	0.8029
AT1G53840		ATPME1	pectin methylesterase 1 (.1)		Lus10026435 [exp]	6.7	0.7744
AT1G11930			Predicted pyridoxal phosphate-...		Lus10020039 [exp]	7.5	0.7987
AT1G11930			Predicted pyridoxal phosphate-...		Lus10015557 [exp]	8.3	0.7479
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10017291 [exp]	8.4	0.7863
AT3G58090			Disease resistance-responsive ...		Lus10009074 [exp]	11.7	0.7942
AT4G16450			unknown protein		Lus10038803 [exp]	14.0	0.7785

Compare expression of checked genes

Lus10015617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.