Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015620 pacid=23147178 polypeptide=Lus10015620 locus=Lus10015620.g ID=Lus10015620.BGIv1.0 annot-version=v1.0 ATGATCGTGACACAGAGAAAGCTACGTTCTAGATTCCTTGTATCTGCAGGCTCAGTGTTCCGTGATGAAGATTCCTCTGGATACAAAGAAACTGTGCTGC AGATTTCAAGCTGGATAGAAGCAAATGGTGATGCTAAGATTGCTGGGGAGAAGAACTCGGTGGTCTTTCGGACGAGCTTAAGAGCAAAGCAGTTACCACC GAAGAAAGCTCCTCCGGCAAAGAAGTTACCACCAAAGAAAGCTCCTCCGGCACCGGTGCCAAACCGGATGAAATCAAATCAGGCGCCTTGA
AA sequence Show only first row Show all	>Lus10015620 pacid=23147178 polypeptide=Lus10015620 locus=Lus10015620.g ID=Lus10015620.BGIv1.0 annot-version=v1.0 MIVTQRKLRSRFLVSAGSVFRDEDSSGYKETVLQISSWIEANGDAKIAGEKNSVVFRTSLRAKQLPPKKAPPAKKLPPKKAPPAPVPNRMKSNQAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015620 [exp]	0	1
AT2G46640			unknown protein		Lus10005993 [exp]	2.0	0.9042
AT5G62440			Protein of unknown function (D...		Lus10024968 [exp]	2.6	0.8794
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024717 [exp]	2.8	0.8835
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024716 [exp]	3.5	0.8868
AT2G22795			unknown protein		Lus10028240 [exp]	5.7	0.8772
AT3G48670		RDM12, IDN2	RNA-DIRECTED DNA METHYLATION 1...		Lus10002305 [exp]	5.8	0.8870
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10001594 [exp]	6.0	0.8422
					Lus10028987 [exp]	7.7	0.7712
AT1G69550			disease resistance protein (TI...		Lus10005376 [exp]	8.1	0.8644
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	9.7	0.8402

Compare expression of checked genes

Lus10015620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.