Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55190 129 / 8e-38 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13710 119 / 8e-34 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT3G13720 116 / 6e-33 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G08770 96 / 1e-24 PRA1.E prenylated RAB acceptor 1.E (.1) AT1G17700 94 / 5e-24 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT2G38360 88 / 1e-21 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT1G04260 81 / 2e-19 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT5G05380 79 / 4e-18 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT3G56110 77 / 2e-17 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT5G01640 77 / 2e-17 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037649 [exp] 199 / 1e-65 AT1G55190 153 / 2e-47 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10005088 [exp] 199 / 3e-65 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10034363 [exp] 189 / 5e-61 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 97 / 9e-25 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10014747 [exp] 90 / 2e-22 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10042535 [exp] 89 / 4e-22 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10033859 [exp] 89 / 9e-22 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10026404 [exp] 84 / 3e-20 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 83 / 3e-19 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G035200 [exp] 139 / 1e-41 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 120 / 4e-34 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.002G044000 [exp] 102 / 2e-27 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G219100 [exp] 101 / 9e-27 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 89 / 3e-22 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.006G104400 [exp] 74 / 4e-16 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.010G183300 [exp] 71 / 4e-15 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.016G126400 [exp] 71 / 5e-15 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.019G124100 [exp] 70 / 9e-15 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.001G472300 [exp] 69 / 2e-14 AT5G56230 115 / 4e-32 prenylated RAB acceptor 1.G2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [flax] [poplar] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Lus10015631 pacid=23147211 polypeptide=Lus10015631 locus=Lus10015631.g ID=Lus10015631.BGIv1.0 annot-version=v1.0 ATGACCAACTACGGCACAATCCCAACCACCACCTCCGCCACCGCCGGAGGCGGCGGAGCCCCCTCCATTCCCTACTCCAACCTCGCCTACATCTCCCGCG CCAAGGACCGAATCCAAGACGGAATCGGAACTCTCCGGCCGTGGAAATCGATGCTCAACCTCCACAGCCTCGCGATCCCGAAGACCCTAGCCGACGCGAT CAGCCGGCTGAGGACGAATTCGGACTACTTCCGGATGAACTACGCCTTAATCGCACTGGGGATCCTCTTCCTTAGCCTCCTCTGGCACCCGATCTCGCTG ATAGTCTTCATCGCCGCCATGGCCGGGTGGCTTTACCTCTACTTCCTCCGCGACGAGCCGATCGTGGTGTTCGGGAAGTTGGTCGACGACCGCGTCGTGC TCGGGACGATGTCCGTGGTCACGGTGGCGGTTCTGCTCCTGACGGGCGTGCTCTGGAACGTGTTCGGGTCTGTCTTGGTCGGCGCCGCGGTGGTTGCGGC TCATGGAGTTGTTAGGAGGACGGAGGACTTGTTTGTCGATGAGGAATCAACCGGGTTCCTCGCCGCCGGCGGTCGTGCGTGA
AA sequence Show only first row Show all	>Lus10015631 pacid=23147211 polypeptide=Lus10015631 locus=Lus10015631.g ID=Lus10015631.BGIv1.0 annot-version=v1.0 MTNYGTIPTTTSATAGGGGAPSIPYSNLAYISRAKDRIQDGIGTLRPWKSMLNLHSLAIPKTLADAISRLRTNSDYFRMNYALIALGILFLSLLWHPISL IVFIAAMAGWLYLYFLRDEPIVVFGKLVDDRVVLGTMSVVTVAVLLLTGVLWNVFGSVLVGAAVVAAHGVVRRTEDLFVDEESTGFLAAGGRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10015631 [exp]	0	1
AT2G01420		PIN4, ATPIN4	ARABIDOPSIS PIN-FORMED 4, Auxi...		Lus10012680 [exp]	2.2	0.8702
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Lus10001347 [exp]	3.5	0.8443
AT4G21310			Protein of unknown function (D...		Lus10007626 [exp]	4.5	0.8699
AT1G61350			ARM repeat superfamily protein...		Lus10002598 [exp]	4.9	0.8437
AT1G25250	C2H2ZnF	ATIDD16	indeterminate(ID)-domain 16 (....		Lus10031314 [exp]	8.5	0.8146
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10018647 [exp]	8.8	0.8358
AT1G78110			unknown protein		Lus10012052 [exp]	9.8	0.7757
AT2G39210			Major facilitator superfamily ...		Lus10014640 [exp]	9.9	0.7970
AT5G03795			Exostosin family protein (.1)		Lus10025178 [exp]	11.0	0.8223
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10033574 [exp]	11.2	0.8336

Compare expression of checked genes

Lus10015631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.