Lus10015633 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37470 166 / 7e-52 alpha/beta-Hydrolases superfamily protein (.1)
AT3G03990 132 / 1e-38 alpha/beta-Hydrolases superfamily protein (.1)
AT3G24420 94 / 8e-24 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037651 211 / 8e-70 AT4G37470 414 / 1e-147 alpha/beta-Hydrolases superfamily protein (.1)
Lus10014859 186 / 1e-59 AT4G37470 442 / 5e-159 alpha/beta-Hydrolases superfamily protein (.1)
Lus10010398 185 / 1e-59 AT4G37470 335 / 1e-116 alpha/beta-Hydrolases superfamily protein (.1)
Lus10019303 180 / 2e-57 AT4G37470 433 / 4e-155 alpha/beta-Hydrolases superfamily protein (.1)
Lus10018686 127 / 1e-36 AT3G03990 448 / 4e-161 alpha/beta-Hydrolases superfamily protein (.1)
Lus10017296 89 / 4e-22 AT3G03990 232 / 7e-76 alpha/beta-Hydrolases superfamily protein (.1)
Lus10013541 89 / 7e-22 AT3G03990 234 / 7e-77 alpha/beta-Hydrolases superfamily protein (.1)
Lus10017735 86 / 9e-21 AT3G24420 290 / 2e-98 alpha/beta-Hydrolases superfamily protein (.1)
Lus10033087 83 / 9e-20 AT3G24420 281 / 3e-95 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G145000 172 / 2e-54 AT4G37470 468 / 7e-169 alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G052000 162 / 1e-50 AT4G37470 451 / 3e-162 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G118900 125 / 6e-36 AT3G03990 440 / 4e-158 alpha/beta-Hydrolases superfamily protein (.1)
Potri.014G016500 120 / 3e-34 AT3G03990 434 / 1e-155 alpha/beta-Hydrolases superfamily protein (.1)
Potri.016G062700 103 / 1e-27 AT3G24420 253 / 3e-84 alpha/beta-Hydrolases superfamily protein (.1)
Potri.006G155500 96 / 1e-24 AT3G24420 331 / 8e-115 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G121000 40 / 0.0003 AT4G36530 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Representative CDS sequence
>Lus10015633 pacid=23147232 polypeptide=Lus10015633 locus=Lus10015633.g ID=Lus10015633.BGIv1.0 annot-version=v1.0
ATGGCATCACTACGAGAAGCTCACAACGTCAAGGTGGTGGGCTCCGGCGACCGGGTCATCGTCTTAGCTCACGGGTTCGGCACCGACCAGTCCGTCTGGA
AGCACCTCCTCCCTCACTTGCTCGCCGACGACGAATTCACGGTCGTCGTTTACGACAACATGGGGGCCGGCACCACCAACCCCGATTTCTTCGACTTCGA
ACGCTACTCCGGCCTCGAAGCCTATGCTGCCGATCTCCTCGCCATCCTCGACGATCTCCACGTCGAATCGTGCATCTATGTCGGCCACTCGGTATCCGCC
ATGATCGGCGTTGTCGCCTCCATCGGTCACCCTCAACTCTTCCTCAAACTCATCCTCCTCGCTGGCTCCCCAAGGTTTGGGATTCAATTTTACGCTCCAA
TTAATATAAATGAATTTCATCCATTTTTAAAGTATCCATTTTGA
AA sequence
>Lus10015633 pacid=23147232 polypeptide=Lus10015633 locus=Lus10015633.g ID=Lus10015633.BGIv1.0 annot-version=v1.0
MASLREAHNVKVVGSGDRVIVLAHGFGTDQSVWKHLLPHLLADDEFTVVVYDNMGAGTTNPDFFDFERYSGLEAYAADLLAILDDLHVESCIYVGHSVSA
MIGVVASIGHPQLFLKLILLAGSPRFGIQFYAPININEFHPFLKYPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37470 alpha/beta-Hydrolases superfam... Lus10015633 0 1
Lus10003479 4.0 0.8861
AT1G07430 HAI2 highly ABA-induced PP2C gene 2... Lus10033955 5.7 0.9188
AT5G15140 Galactose mutarotase-like supe... Lus10007251 11.1 0.8614
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Lus10024830 11.7 0.8360
AT4G37470 alpha/beta-Hydrolases superfam... Lus10000054 12.1 0.9114
AT5G40690 unknown protein Lus10015261 26.5 0.8870
Lus10024012 32.6 0.8134
AT5G06500 MADS AGL96 AGAMOUS-like 96 (.1) Lus10029367 34.7 0.8904
AT2G24840 MADS DIA, AGL61 DIANA, AGAMOUS-like 61 (.1) Lus10030663 40.0 0.8649
AT1G21000 PLATZ transcription factor fam... Lus10040292 41.4 0.8934

Lus10015633 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.