Lus10015649 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69550 76 / 7e-16 disease resistance protein (TIR-NBS-LRR class) (.1)
AT1G27180 71 / 3e-14 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT5G44510 66 / 2e-12 TAO1 target of AVRB operation1 (.1)
AT4G19520 64 / 7e-12 disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G45200 64 / 7e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT2G17050 64 / 1e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT2G14080 63 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G17880 62 / 3e-11 CSA1 constitutive shade-avoidance1, disease resistance protein (TIR-NBS-LRR class) (.1)
AT4G16960 62 / 4e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G25510 61 / 7e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015648 285 / 2e-89 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10024150 181 / 4e-53 AT1G69550 186 / 9e-49 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10001537 176 / 1e-51 AT5G44510 175 / 1e-45 target of AVRB operation1 (.1)
Lus10010223 162 / 4e-46 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10042778 158 / 8e-45 AT4G12010 185 / 1e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10001281 145 / 5e-43 AT1G69550 67 / 2e-12 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10018021 130 / 9e-35 AT4G12010 434 / 5e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10023051 126 / 1e-33 AT4G12010 415 / 2e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10011580 118 / 1e-30 AT5G64500 625 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G030700 92 / 2e-21 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G030318 80 / 2e-17 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G031899 77 / 3e-16 AT1G69550 469 / 6e-141 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.019G068300 77 / 3e-16 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G069200 76 / 6e-16 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.017G103701 73 / 7e-15 AT5G17680 544 / 5e-170 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G031101 72 / 1e-14 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.004G088500 71 / 2e-14 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.019G070393 71 / 2e-14 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G070700 71 / 3e-14 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10015649 pacid=23147275 polypeptide=Lus10015649 locus=Lus10015649.g ID=Lus10015649.BGIv1.0 annot-version=v1.0
ATGAGTACCTTAACTTCTCTTCATGTATTCTGTTGTAGAAGCCTCACAAGTATTCCAACTAGCATCAGCAATTTAAGATCTCTGATATCGCTTTGTTTAG
TAGAGACGGGTATTAAGTCTCTGCCTTCTAGCATCCAAGAACTAAGGCAGCTTTTTTCGATTGATCTTAGAGATTGCAAAAGCCTCGAGTCAATTCCAAA
CAGTATCCATAAGCTTTCCAAGTTGGTAACTTTGTCAATGTCTGGCTGTGAGATCATTATATCTTTGCCTGAACTCCCACCAAATCTGAAGACCTTGAAC
GTAAGTGGTTGCAAGTCTTTACAAGCTCTACCAAGCAACACATGTAAGCTGTTGTACCTGAATACGATCCATTTTGACGGATGTCCACAATTGGACCAGG
CTATACCTGGCGAGTTCGTGGCAAATTTCCTCGTTCATGCCAGCTTGTCTCCGTCATATGAGATTGAAGCAGTAACAATTGGACCCACATCCATGGACTC
CAACATGGCTTCAAATCTTGGCTCCTTGGCTTCATGTAGTCTCAAACACAAACTTAGGTGTGACCTGCCAACAAATGAAGTCACTGCAGCTCCTATCCCC
AAGAAGATATAA
AA sequence
>Lus10015649 pacid=23147275 polypeptide=Lus10015649 locus=Lus10015649.g ID=Lus10015649.BGIv1.0 annot-version=v1.0
MSTLTSLHVFCCRSLTSIPTSISNLRSLISLCLVETGIKSLPSSIQELRQLFSIDLRDCKSLESIPNSIHKLSKLVTLSMSGCEIIISLPELPPNLKTLN
VSGCKSLQALPSNTCKLLYLNTIHFDGCPQLDQAIPGEFVANFLVHASLSPSYEIEAVTIGPTSMDSNMASNLGSLASCSLKHKLRCDLPTNEVTAAPIP
KKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69550 disease resistance protein (TI... Lus10015649 0 1
AT4G12010 Disease resistance protein (TI... Lus10015650 1.0 0.8260
AT2G34050 unknown protein Lus10007055 5.3 0.5949
AT5G45840 Leucine-rich repeat protein ki... Lus10029228 6.5 0.7797
AT1G53000 AtCKS, KDSB CMP-KDO synthetase, Nucleotide... Lus10040889 15.1 0.6113
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10005194 22.8 0.5936
AT1G04670 unknown protein Lus10002298 24.2 0.5936
Lus10000273 25.5 0.5936
AT1G17930 Aminotransferase-like, plant m... Lus10001981 26.7 0.5936
Lus10039450 27.5 0.6312
AT4G34540 NmrA-like negative transcripti... Lus10012146 27.9 0.5936

Lus10015649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.