Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037674 [exp] 102 / 1e-29 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G065900 [exp] 71 / 3e-17 ND / Potri.001G168400 [exp] 64 / 1e-14 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015658 pacid=23147213 polypeptide=Lus10015658 locus=Lus10015658.g ID=Lus10015658.BGIv1.0 annot-version=v1.0 ATGACTACCCAATGTTCTTACAATGCTGCCCGAAACCCTCCGTCGTCTCAAAGAGGAATAGCCATGGTATTGGCTCTCGTGTCTGCGGTCGTTCTGTCTC CTTTATACACTAGTCGGAGGGACGATCATCATCATCCATCACGGTTTTATCATTACGAGACCAGTTGGAGCTCCGGTTTGGTTTTGCCAATGGTTTTGGC GGGGTTGATAATCGCTATCAAGTCGACATAA
AA sequence Show only first row Show all	>Lus10015658 pacid=23147213 polypeptide=Lus10015658 locus=Lus10015658.g ID=Lus10015658.BGIv1.0 annot-version=v1.0 MTTQCSYNAARNPPSSQRGIAMVLALVSAVVLSPLYTSRRDDHHHPSRFYHYETSWSSGLVLPMVLAGLIIAIKST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015658 [exp]	0	1
AT1G29660			GDSL-like Lipase/Acylhydrolase...		Lus10032316 [exp]	1.0	0.9436
AT3G24330			O-Glycosyl hydrolases family 1...		Lus10033082 [exp]	2.8	0.9079
AT5G08350			GRAM domain-containing protein...		Lus10040999 [exp]	3.5	0.9336
AT1G63300			Myosin heavy chain-related pro...		Lus10014980 [exp]	3.7	0.8830
AT1G60060			Serine/threonine-protein kinas...		Lus10012986 [exp]	4.2	0.9175
AT5G56270	WRKY	ATWRKY2, WRKY2,...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10019898 [exp]	5.7	0.9128
AT4G24180		ATTLP1	THAUMATIN-LIKE PROTEIN 1 (.1)		Lus10017266 [exp]	5.9	0.9080
AT3G11680			Aluminium activated malate tra...		Lus10021272 [exp]	6.3	0.9093
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10014905 [exp]	6.5	0.9082
AT1G49230			RING/U-box superfamily protein...		Lus10005815 [exp]	6.5	0.8539

Compare expression of checked genes

Lus10015658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.