Lus10015672 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015672 pacid=23147205 polypeptide=Lus10015672 locus=Lus10015672.g ID=Lus10015672.BGIv1.0 annot-version=v1.0
ATGGATGTGTCCGGAATGTCTTGGTCTTCAGACGAGACTCAACTGGCCAAGAACCAGAAATTAGAGTACAACCAGATTTTGAATGTGACTGGATATCAAG
CTAGTAACACAGTCATGTTCTTGACGATTGAAGCCCTGGATCGTGAGACCCGTGACACTGATAAGTACCAAGCTGTTGTTAGTTTTCAAGATTCTCCCCA
TGTCCGTATCTTCAGGAGAGAATCAACCGGCGAAGGTGCGTAG
AA sequence
>Lus10015672 pacid=23147205 polypeptide=Lus10015672 locus=Lus10015672.g ID=Lus10015672.BGIv1.0 annot-version=v1.0
MDVSGMSWSSDETQLAKNQKLEYNQILNVTGYQASNTVMFLTIEALDRETRDTDKYQAVVSFQDSPHVRIFRRESTGEGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015672 0 1
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023904 8.4 0.7674
AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-li... Lus10022285 10.2 0.7674
Lus10000380 11.8 0.7674
Lus10010383 13.2 0.7674
AT2G39080 EMB2799 EMBRYO DEFECTIVE 2799, NAD(P)-... Lus10037911 14.5 0.7666
Lus10009632 15.7 0.7645
AT2G24280 alpha/beta-Hydrolases superfam... Lus10024449 17.0 0.7538
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10015092 18.5 0.7516
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10042922 20.8 0.7049
AT5G28210 mRNA capping enzyme family pro... Lus10040496 21.7 0.7421

Lus10015672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.