Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	No hit found
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015694 pacid=23147269 polypeptide=Lus10015694 locus=Lus10015694.g ID=Lus10015694.BGIv1.0 annot-version=v1.0 ATGGAGATGAAGAAGGTCGCCTGCGCCGCCGTGGTCGTCGCCGCCGCCTCCATGAGCGCCGTCTTGGCACAGGACTTCGCCCCCGCCGCCGGACCTGGCT CCGCTGAAGGACCTGCAGGAGGACCAGCTGCTGGTGGACCGGCGGCGAATGGCGCCTCTGCCGCTGCATTGCCGGCGTTGGGGTCTTTGATCGGCGCCTC CGTTGTCTCCTTCATTGCCTGCTACTTCCAGTAA
AA sequence Show only first row Show all	>Lus10015694 pacid=23147269 polypeptide=Lus10015694 locus=Lus10015694.g ID=Lus10015694.BGIv1.0 annot-version=v1.0 MEMKKVACAAVVVAAASMSAVLAQDFAPAAGPGSAEGPAGGPAAGGPAANGASAAALPALGSLIGASVVSFIACYFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015694 [exp]	0	1
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10006980 [exp]	3.5	0.9321
AT3G51930			Transducin/WD40 repeat-like su...		Lus10039568 [exp]	18.8	0.8787
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10015634 [exp]	19.0	0.8703
AT4G30420			nodulin MtN21 /EamA-like trans...		Lus10023211 [exp]	21.0	0.8628
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10015127 [exp]	23.5	0.8782
AT1G16890		UBC36 ,UBC13B	UBIQUITIN CONJUGATING ENZYME 1...		Lus10000615 [exp]	28.2	0.8332
AT1G75030		ATLP-3	thaumatin-like protein 3 (.1)		Lus10032726 [exp]	32.9	0.8694
AT5G63180			Pectin lyase-like superfamily ...		Lus10036946 [exp]	33.5	0.8675
AT3G19430			late embryogenesis abundant pr...		Lus10021837 [exp]	40.5	0.8677
AT5G11590	AP2_ERF	DREB3, TINY2	TINY2, Integrase-type DNA-bind...		Lus10043240 [exp]	42.4	0.8675

Compare expression of checked genes

Lus10015694 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.