Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56710 173 / 3e-57 Ribosomal protein L31e family protein (.1.2) AT4G26230 172 / 1e-56 Ribosomal protein L31e family protein (.1) AT2G19740 169 / 1e-55 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037703 [exp] 203 / 5e-69 AT5G56710 199 / 1e-67 Ribosomal protein L31e family protein (.1.2) Lus10025830 [exp] 172 / 7e-57 AT2G19740 200 / 5e-68 Ribosomal protein L31e family protein (.1) Lus10042028 [exp] 170 / 6e-56 AT2G19740 198 / 3e-67 Ribosomal protein L31e family protein (.1) Lus10018032 [exp] 163 / 3e-53 AT2G19740 191 / 3e-64 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 172 / 8e-53 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G269600 [exp] 176 / 2e-58 AT2G19740 162 / 5e-53 Ribosomal protein L31e family protein (.1) Potri.009G064100 [exp] 176 / 3e-58 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.018G070100 [exp] 169 / 2e-55 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [flax] [poplar] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Lus10015698 pacid=23147274 polypeptide=Lus10015698 locus=Lus10015698.g ID=Lus10015698.BGIv1.0 annot-version=v1.0 ATGGCGGAAAAGCCCAGGAAAGTAAGGAAAGAGGAGATCGTCACCAGAGAATACACCATCAACCTCCACAAACGCCTCCATGGATGCACTTTCAAGAAGA AGGCACCAAAGGCCATCAAGGAGATAAGGAAGTTCGCACAGAAGGCAATGGGAACAACCGATTGCAGAGTCGACGTGAAGCTGAACAAGCAGATCTGGAG CAAAGGGATCAGGAGTGTTCCGAGGAGGGTTCGAGTTCGTATTGCGAGGAAGAGGAACGACGAGGAAGATGCCAAGGAAGAGTTCTACTCTCTTGTCACT GCTGCCGAGATTCCTGAGGAAGGGCTGAAGGGTATGGGGACTAAGGTCATCGACGAGGAAGATTAG
AA sequence Show only first row Show all	>Lus10015698 pacid=23147274 polypeptide=Lus10015698 locus=Lus10015698.g ID=Lus10015698.BGIv1.0 annot-version=v1.0 MAEKPRKVRKEEIVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTTDCRVDVKLNKQIWSKGIRSVPRRVRVRIARKRNDEEDAKEEFYSLVT AAEIPEEGLKGMGTKVIDEED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56710			Ribosomal protein L31e family ...		Lus10015698 [exp]	0	1
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	1.0	0.9689
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10020499 [exp]	1.4	0.9630
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10015106 [exp]	3.9	0.9571
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	4.2	0.9577
AT4G21105			cytochrome-c oxidases;electron...		Lus10006275 [exp]	4.2	0.9494
AT2G44820			unknown protein		Lus10036053 [exp]	5.5	0.9417
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10032212 [exp]	6.3	0.9577
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	7.3	0.9553
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	8.9	0.9489
AT3G16780			Ribosomal protein L19e family ...		Lus10016829 [exp]	8.9	0.9415

Compare expression of checked genes

Lus10015698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.