Lus10015706 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50560 166 / 5e-48 CYP705A25 "cytochrome P450, family 705, subfamily A, polypeptide 25", cytochrome P450, family 705, subfamily A, polypeptide 25 (.1)
AT1G50520 162 / 1e-46 CYP705A27 "cytochrome P450, family 705, subfamily A, polypeptide 27", cytochrome P450, family 705, subfamily A, polypeptide 27 (.1)
AT4G15350 160 / 1e-45 CYP705A2 "cytochrome P450, family 705, subfamily A, polypeptide 2", cytochrome P450, family 705, subfamily A, polypeptide 2 (.1)
AT3G20940 159 / 3e-45 CYP705A31P, CYP705A30 "cytochrome P450, family 705, subfamily A, polypeptide 30", cytochrome P450, family 705, subfamily A, polypeptide 30 (.1)
AT3G20950 157 / 1e-44 CYP705A32 "cytochrome P450, family 705, subfamily A, polypeptide 32", cytochrome P450, family 705, subfamily A, polypeptide 32 (.1)
AT5G47990 156 / 3e-44 THAD1, THAD, CYP705A5 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1)
AT3G20140 154 / 1e-43 CYP705A23 "cytochrome P450, family 705, subfamily A, polypeptide 23", cytochrome P450, family 705, subfamily A, polypeptide 23 (.1)
AT3G20080 150 / 6e-43 CYP705A15 "cytochrome P450, family 705, subfamily A, polypeptide 15", cytochrome P450, family 705, subfamily A, polypeptide 15 (.1.2.3)
AT3G20130 151 / 1e-42 GPS1, CYP705A22 gravity persistence signal 1, "cytochrome P450, family 705, subfamily A, polypeptide 22", cytochrome P450, family 705, subfamily A, polypeptide 22 (.1.2)
AT3G20100 150 / 7e-42 CYP705A19 "cytochrome P450, family 705, subfamily A, polypeptide 19", cytochrome P450, family 705, subfamily A, polypeptide 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035502 143 / 3e-39 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Lus10023827 134 / 7e-36 AT2G42250 652 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1)
Lus10027798 122 / 1e-32 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Lus10040868 119 / 1e-30 AT5G06900 434 / 5e-148 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Lus10005878 119 / 1e-30 AT5G06900 440 / 1e-150 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Lus10019463 113 / 5e-30 AT3G26270 217 / 1e-67 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1)
Lus10034230 117 / 1e-29 AT1G13110 400 / 9e-135 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1)
Lus10034502 115 / 2e-29 AT4G31500 477 / 1e-166 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1)
Lus10043313 115 / 4e-29 AT3G48280 390 / 3e-131 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G065000 215 / 9e-67 AT5G47990 425 / 1e-144 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1)
Potri.009G066300 205 / 9e-63 AT3G20140 419 / 2e-142 "cytochrome P450, family 705, subfamily A, polypeptide 23", cytochrome P450, family 705, subfamily A, polypeptide 23 (.1)
Potri.001G270900 202 / 1e-61 AT5G47990 419 / 2e-142 THALIAN-DIOL DESATURASE, "cytochrome P450, family 705, subfamily A, polypeptide 5", cytochrome P450, family 705, subfamily A, polypeptide 5 (.1)
Potri.009G066200 201 / 3e-61 AT4G15350 410 / 7e-139 "cytochrome P450, family 705, subfamily A, polypeptide 2", cytochrome P450, family 705, subfamily A, polypeptide 2 (.1)
Potri.016G052600 154 / 3e-43 AT2G42250 512 / 2e-178 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1)
Potri.006G190800 152 / 8e-43 AT2G42250 509 / 2e-177 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1)
Potri.006G057900 139 / 1e-37 AT2G42250 725 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1)
Potri.016G049800 133 / 1e-35 AT5G06900 536 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Potri.006G058200 127 / 2e-33 AT5G06900 584 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Potri.009G065100 123 / 1e-32 AT1G50520 283 / 1e-90 "cytochrome P450, family 705, subfamily A, polypeptide 27", cytochrome P450, family 705, subfamily A, polypeptide 27 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00067 p450 Cytochrome P450
Representative CDS sequence
>Lus10015706 pacid=23147248 polypeptide=Lus10015706 locus=Lus10015706.g ID=Lus10015706.BGIv1.0 annot-version=v1.0
ATGAAGGGAGAATTTGGGGCCTTGGGTAAGGAGCTGATGACGCTGACTAATAATACTACGTGTAGGATGGCAATGAGCGCCAGGTGCTCGACGGAATGCG
GCAATGAAGCTGAGAGGTGCAGGGAGCTGGTTAAGGGGGCACACAGCCTGACTATTAAAATGGCGGTTGCTAATCTGTTTGGTCCGCTGAGAAAGTTGGT
GGTACATTTGCTATTCTGCAAGCAGGCCAAGGATTTGCCCGCTCAGTACGACGAGTTGCTGGAAGGAATTCTGAAGGAGCGTGAAGGAAGAGCAACTAAT
GAAAGCTGTATATTCTTCTGCAAGCTGTTGACCGACCCAATTCTCACCCGAAATAAGTATAATAGCCGACGTACCGTTTTCATTTATGAATGCTCTGATT
CCTTTCAGGATCTATTCATTGCTGGGACAAGTGCAACAGCGGATATAATGGAGTGGACAATGGCGGAGCTCCTGAACCATCCTGACATCTCCGTCAAGAG
ATCATCCAGGCTACATCCGCCAGCAGTTGTGGCACCAAGGGAGTCCAGAGAGGCTTGTAAGCTAGGAGGGTTCGACATACCGAAAGGAATACCAGTGGCT
GTCAATACATTCTCCATAATGCGAGATCCTGAGGTATGGGCCGATCCAGATGAGTTCTGCCCCGAGAGATTCGTGCACGATAATGGAGTAGGGATGATGG
TTGCCGGTTTCATTCCGTTCGGTGGTGGGAGAAGGATGTGTCCTGGTTCGAACATCCTTATTTATTTGTACATGATTAGTAATTTTAGTACACCCCCATA
G
AA sequence
>Lus10015706 pacid=23147248 polypeptide=Lus10015706 locus=Lus10015706.g ID=Lus10015706.BGIv1.0 annot-version=v1.0
MKGEFGALGKELMTLTNNTTCRMAMSARCSTECGNEAERCRELVKGAHSLTIKMAVANLFGPLRKLVVHLLFCKQAKDLPAQYDELLEGILKEREGRATN
ESCIFFCKLLTDPILTRNKYNSRRTVFIYECSDSFQDLFIAGTSATADIMEWTMAELLNHPDISVKRSSRLHPPAVVAPRESREACKLGGFDIPKGIPVA
VNTFSIMRDPEVWADPDEFCPERFVHDNGVGMMVAGFIPFGGGRRMCPGSNILIYLYMISNFSTPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50560 CYP705A25 "cytochrome P450, family 705, ... Lus10015706 0 1
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10026749 1.0 0.9098
AT5G13530 KEG KEEP ON GOING, protein kinases... Lus10002621 2.0 0.7585
AT2G15220 Plant basic secretory protein ... Lus10014107 2.4 0.8172
Lus10039943 4.2 0.8345
AT2G48020 Major facilitator superfamily ... Lus10042676 10.1 0.6903
AT5G51490 Plant invertase/pectin methyle... Lus10027203 11.0 0.7307
AT1G22900 Disease resistance-responsive ... Lus10021083 17.3 0.6497
AT4G37940 MADS AGL21 AGAMOUS-like 21 (.1) Lus10020477 21.0 0.6754
Lus10024992 22.4 0.6694
AT2G26490 Transducin/WD40 repeat-like su... Lus10016289 23.9 0.6625

Lus10015706 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.