Lus10015714 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26550 219 / 1e-74 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G18040 62 / 5e-13 PIN1AT "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
AT5G19370 47 / 1e-06 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019084 229 / 3e-78 AT1G26550 225 / 4e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10014266 61 / 2e-12 AT2G18040 199 / 9e-68 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Lus10025967 61 / 6e-12 AT2G18040 200 / 8e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Lus10000413 51 / 7e-08 AT5G19370 240 / 1e-77 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Lus10026105 51 / 7e-08 AT5G19370 233 / 8e-76 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G089900 212 / 1e-71 AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.007G013400 66 / 3e-14 AT2G18040 198 / 4e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1)
Potri.009G069300 50 / 1e-07 AT5G19370 281 / 3e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00639 Rotamase PPIC-type PPIASE domain
Representative CDS sequence
>Lus10015714 pacid=23167728 polypeptide=Lus10015714 locus=Lus10015714.g ID=Lus10015714.BGIv1.0 annot-version=v1.0
ATGATGGTTAAACTCGTCAATCATCATGAATATGATTATCTGCATTTCTCTATCGGCTTCCAAGCAATGGGGAAGAAAGATGGGGCAAAAGGCAAAGGTA
AGGCAGCTAGTAGCAGTGATGAAAATGCTTCAAAGGGTAAGGGAAAAGCTGGAAAGGCTGATGGACTTGGCACATGCACATATGTAAAAGCAAGGCATAT
TTTGTGCGAGAAGCAAGGTAAGATTAATGAGGCATACAAGAAACTGCAAGACGGTTGGCTAAGCAATGGAGATAAAGTCCCCCCCGCTGAGTTTGCGAAG
GTAGCGACGGAGTATTCAGAGTGCCCTTCGGGAAAGAAGGGTGGAGACCTTGGATGGTTTCCGCGTGGGAAGATGGCCGGTCCGTTCCAAGAGGTTGCTT
TCAACACCCCAGTTGGAGCTACTAGTGCACCGTTTAAGTCAACACATGGGTATCACATAATCCTATCTGAAGGCCGAAAGAATTGA
AA sequence
>Lus10015714 pacid=23167728 polypeptide=Lus10015714 locus=Lus10015714.g ID=Lus10015714.BGIv1.0 annot-version=v1.0
MMVKLVNHHEYDYLHFSIGFQAMGKKDGAKGKGKAASSSDENASKGKGKAGKADGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLSNGDKVPPAEFAK
VATEYSECPSGKKGGDLGWFPRGKMAGPFQEVAFNTPVGATSAPFKSTHGYHIILSEGRKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10015714 0 1
AT1G74250 DNAJ heat shock N-terminal dom... Lus10017846 1.4 0.8666
AT1G67350 unknown protein Lus10015785 1.4 0.8601
AT2G29960 CYP19-4, ATCYP5... CYCLOPHILIN 19-4, ARABIDOPSIS ... Lus10014846 2.4 0.8284
AT1G55460 C2H2ZnF DNA/RNA-binding protein Kin17,... Lus10001696 3.0 0.8521
AT3G02120 hydroxyproline-rich glycoprote... Lus10032981 3.6 0.7931
AT5G54855 Pollen Ole e 1 allergen and ex... Lus10019622 4.2 0.8169
AT4G05530 SDRA, IBR1 SHORT-CHAIN DEHYDROGENASE/REDU... Lus10015542 5.9 0.8344
AT4G31270 Trihelix sequence-specific DNA binding ... Lus10026986 6.9 0.8175
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10023188 7.2 0.8374
AT5G42850 Thioredoxin superfamily protei... Lus10037477 7.5 0.8188

Lus10015714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.