Lus10015717 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61400 152 / 3e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G38730 82 / 1e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39710 74 / 6e-15 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G64320 72 / 2e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G55840 70 / 1e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G48810 68 / 6e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62930 67 / 1e-12 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12700 67 / 1e-12 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
AT3G22470 67 / 2e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G01110 66 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019080 394 / 1e-140 AT5G61400 159 / 8e-45 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032174 79 / 2e-16 AT5G38730 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008185 78 / 3e-16 AT1G19290 864 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027974 77 / 4e-16 AT1G19290 480 / 1e-156 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013077 76 / 2e-15 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026465 75 / 4e-15 AT1G05670 197 / 6e-55 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10039056 70 / 2e-13 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10034421 70 / 2e-13 AT2G02150 706 / 0.0 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014513 66 / 2e-12 AT5G38730 446 / 7e-155 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G015900 71 / 7e-14 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G075900 71 / 9e-14 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G071600 69 / 2e-13 AT5G40400 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G040200 69 / 2e-13 AT1G19290 883 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G068400 69 / 2e-13 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G108600 69 / 4e-13 AT5G38730 762 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G105700 68 / 8e-13 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.004G147700 67 / 9e-13 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G154800 67 / 1e-12 AT4G20090 816 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G066600 67 / 1e-12 AT2G26790 521 / 4e-174 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10015717 pacid=23167729 polypeptide=Lus10015717 locus=Lus10015717.g ID=Lus10015717.BGIv1.0 annot-version=v1.0
ATGTATAAGTCGCTTATTCCAAAATGCTTTATCGTCAACGCTCCCCTTAACCCTCGTCTCTCCCTTTTCCTATTTTCTTCTTCTTACTCTTCCCCCACCT
CTTTGCTGCCTTCTGATCTCACAGCCGCCATTCTCTACTCAAGAACCGCTGACCAAGCCCTCCAACTCTTCACTTCCATCGTAAATCGCAACTCCAAATC
CCCAGTGAAAAACCTTCCACATTACTCCGCCGTGATTCACGTGTTAACAGGTGCTGGTGCGTACACTCCCGCCAGGTGCTTGATAAAAGGCCTGATCCAG
TCCTTCCTGAAATCCCACGACCCAAAACGTGCCAGCTCGTTGATTTTCGACGCTCTCAGTCGATTGGAGAGCTCCAAATTCACTTCCGATGTGTTTGGGA
CGTTGATTATTGCACTCTGCGAGGCGGGACTTGTTGACGAAGCCCTGCGGGTGCGCCGCAAGATTGGTGTTTTACCTGCGAGGCAAGCTTGCAATGCCCT
TATGAACGGGCTAGTTAAGAAAGGGGGATTCGACTCCATGTGGGCAATTTATGAAGAAATGGTTTCCGATGGGTTGGTGCCTAGTGTTGTCAGTTATGGC
GTACTGATCAATGCTTGTTGCTGCCAAGGTGATCTAATAAAGGCGGCGTCTTTGATTAGCGAGATTATGGAGAAAGGGATTCAGCCCCACCGTTGTGATC
TACACAACTCTCATTCGTGGGTTTTGCTGTGA
AA sequence
>Lus10015717 pacid=23167729 polypeptide=Lus10015717 locus=Lus10015717.g ID=Lus10015717.BGIv1.0 annot-version=v1.0
MYKSLIPKCFIVNAPLNPRLSLFLFSSSYSSPTSLLPSDLTAAILYSRTADQALQLFTSIVNRNSKSPVKNLPHYSAVIHVLTGAGAYTPARCLIKGLIQ
SFLKSHDPKRASSLIFDALSRLESSKFTSDVFGTLIIALCEAGLVDEALRVRRKIGVLPARQACNALMNGLVKKGGFDSMWAIYEEMVSDGLVPSVVSYG
VLINACCCQGDLIKAASLISEIMEKGIQPHRCDLHNSHSWVLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61400 Pentatricopeptide repeat (PPR)... Lus10015717 0 1
AT2G19430 DWA1, AtTHO6 DWD (DDB1-binding WD40 protein... Lus10027630 3.3 0.8841
AT3G09370 MYB ATMYB3R-3, ATMY... myb domain protein 3R3, myb do... Lus10024394 8.8 0.8435
AT3G58560 DNAse I-like superfamily prote... Lus10012293 12.5 0.8381
AT5G06600 AtUBP12, UBP12 ubiquitin-specific protease 12... Lus10043456 13.1 0.8454
AT5G04610 S-adenosyl-L-methionine-depend... Lus10003963 15.3 0.8079
AT5G55840 Pentatricopeptide repeat (PPR)... Lus10037968 19.4 0.8389
AT1G79190 ARM repeat superfamily protein... Lus10016753 20.3 0.8398
AT1G04390 BTB/POZ domain-containing prot... Lus10027380 22.2 0.8206
AT5G19420 Regulator of chromosome conden... Lus10009701 24.7 0.8077
AT5G22450 unknown protein Lus10004878 24.7 0.8317

Lus10015717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.