Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12910 61 / 5e-11 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 59 / 3e-10 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G63790 56 / 3e-09 NAC ANAC102 NAC domain containing protein 102 (.1) AT2G43000 55 / 5e-09 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT3G18400 55 / 7e-09 NAC ANAC058 NAC domain containing protein 58 (.1) AT4G36160 55 / 7e-09 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2, NAC domain containing protein 76 (.1) AT3G04070 55 / 7e-09 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G17730 54 / 8e-09 NAC ANAC057 NAC domain containing protein 57 (.1) AT3G15500 54 / 1e-08 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT4G01520 54 / 1e-08 NAC ANAC067 NAC domain containing protein 67 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003458 [exp] 303 / 8e-106 AT4G27410 65 / 2e-12 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10034700 [exp] 84 / 5e-20 AT3G18400 76 / 2e-16 NAC domain containing protein 58 (.1) Lus10020883 [exp] 57 / 9e-10 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 57 / 1e-09 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10041822 [exp] 57 / 2e-09 AT2G18060 352 / 3e-120 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10028372 [exp] 57 / 2e-09 AT2G18060 349 / 4e-119 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10036117 [exp] 56 / 2e-09 AT3G15510 241 / 2e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10007410 [exp] 56 / 3e-09 AT3G15510 241 / 1e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10025690 [exp] 56 / 3e-09 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G205400 [exp] 59 / 2e-10 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1) Potri.005G069500 [exp] 59 / 3e-10 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G099400 [exp] 57 / 8e-10 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.016G076100 [exp] 56 / 1e-09 AT5G22380 214 / 2e-69 NAC domain containing protein 90 (.1) Potri.001G404100 [exp] 56 / 2e-09 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.012G038100 [exp] 56 / 3e-09 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1) Potri.019G083600 [exp] 56 / 4e-09 AT1G71930 320 / 4e-109 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.002G057200 [exp] 55 / 5e-09 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1) Potri.001G256600 [exp] 54 / 9e-09 AT3G04070 190 / 7e-56 NAC domain containing protein 47 (.1.2) Potri.004G038000 [exp] 54 / 1e-08 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10015743 pacid=23167657 polypeptide=Lus10015743 locus=Lus10015743.g ID=Lus10015743.BGIv1.0 annot-version=v1.0 ATGATGAATTCTTCTGTGGTGTCAAATGGCGGAGGAGGAAGAAGACGACTGCTAGTGTCGTCGGAAGAGACGGAGGTTGCCAAGACGTTCCCGCTTGGGT ACAGGTTCAAGCCCACCGACCACGAATTGGTGAAGCATTACTTGGTGCCCAAATCCATGGGTTTGGAATCGGATTCTGCGACCCTTGGCTGTATTGGCAA TACTATGAACGCCTCCGATTTCTTTGCACTCCCACCCTATGATCTTGTGTCTCCCATTGCCAAAAAAGAGGAGTGGTATGTATTCATTCACCAAGCAAAT GAAGACACCAAACAAGGTGATAACGACGACAACAAACTGACGGTGACAAGGACAGTAGATGGAGAAGGATTCTGGGAATCAAACAAGAGCTTCGACCTGA CAATTTGTGACCACTCCTCTGGATTGCCGCTAGGCTTCAAGTCTCGGTTCACTTACTATTTGTCTTCTTCCACCCGCGGCATACTGGAAACTGAATGGAA ACTCGACGAGTATCGCCTCTTCAGCCCTCCGAATTCCAAGGTATTGTCGACGCATGGATCCTTGATCAACTGTACTATTACGTACAGAATCAATGTCTAG
AA sequence Show only first row Show all	>Lus10015743 pacid=23167657 polypeptide=Lus10015743 locus=Lus10015743.g ID=Lus10015743.BGIv1.0 annot-version=v1.0 MMNSSVVSNGGGGRRRLLVSSEETEVAKTFPLGYRFKPTDHELVKHYLVPKSMGLESDSATLGCIGNTMNASDFFALPPYDLVSPIAKKEEWYVFIHQAN EDTKQGDNDDNKLTVTRTVDGEGFWESNKSFDLTICDHSSGLPLGFKSRFTYYLSSSTRGILETEWKLDEYRLFSPPNSKVLSTHGSLINCTITYRINV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10015743 [exp]	0	1
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Lus10015243 [exp]	1.0	0.9014
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	5.8	0.8855
AT5G36930			Disease resistance protein (TI...		Lus10005827 [exp]	6.0	0.7839
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	7.1	0.8855
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	8.2	0.8855
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	8.9	0.8827
					Lus10013299 [exp]	9.3	0.7371
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	9.5	0.8687
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	10.0	0.8456
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	10.1	0.8809

Compare expression of checked genes

Lus10015743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.