Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003455 [exp] 183 / 5e-57 AT3G02100 291 / 1e-93 UDP-Glycosyltransferase superfamily protein (.1) Lus10003454 [exp] 155 / 3e-46 AT3G02100 268 / 1e-84 UDP-Glycosyltransferase superfamily protein (.1) Lus10015749 [exp] 136 / 4e-39 AT3G02100 274 / 6e-87 UDP-Glycosyltransferase superfamily protein (.1) Lus10003453 [exp] 135 / 1e-38 AT3G02100 276 / 6e-88 UDP-Glycosyltransferase superfamily protein (.1) Lus10015751 [exp] 132 / 2e-37 AT3G02100 281 / 7e-90 UDP-Glycosyltransferase superfamily protein (.1) Lus10015744 [exp] 114 / 5e-31 AT3G02100 271 / 6e-86 UDP-Glycosyltransferase superfamily protein (.1) Lus10015746 [exp] 64 / 6e-13 AT3G02100 300 / 4e-97 UDP-Glycosyltransferase superfamily protein (.1) Lus10015750 [exp] 62 / 3e-12 AT3G02100 298 / 2e-96 UDP-Glycosyltransferase superfamily protein (.1) Lus10015745 [exp] 59 / 4e-11 AT3G02100 288 / 1e-92 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G021200 [exp] 45 / 2e-06 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G021700 [exp] 45 / 2e-06 AT1G22400 524 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.017G091500 [exp] 44 / 6e-06 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G022500 [exp] 40 / 0.0002 AT1G22340 535 / 0.0 UDP-glucosyl transferase 85A7 (.1) Potri.004G123500 [exp] 39 / 0.0004 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015747 pacid=23167704 polypeptide=Lus10015747 locus=Lus10015747.g ID=Lus10015747.BGIv1.0 annot-version=v1.0 ATGCTCAAGCTGGCACATAAGCTGACCGACCATGGCATCAACGTCACCGTCGCTAATTTGGATTTCATTCACCAAAAGATTATACCTCAGCAACAGCGGA AACAGAGCCATGGTACTGCTGGTTTCAGGCTGGTTTCGCTTCCTGATGGATTCGGTCCCGATTCCGACAACAGCGATGTAGTATTGCTTACAGAGACAGT GCAGAAAGTACTTCCCGTTCGATTGCGGGAGCTGCTGATTCAGCAGCAGTCTCTAAGTAGTAATGATGAAGAGCAAGATAACTTCAGTTGGGTCATTGCA TCCTCCAAAATCAGTAATATACATTGCATTCGGAAGCAATCGCGGTTCTGA
AA sequence Show only first row Show all	>Lus10015747 pacid=23167704 polypeptide=Lus10015747 locus=Lus10015747.g ID=Lus10015747.BGIv1.0 annot-version=v1.0 MLKLAHKLTDHGINVTVANLDFIHQKIIPQQQRKQSHGTAGFRLVSLPDGFGPDSDNSDVVLLTETVQKVLPVRLRELLIQQQSLSSNDEEQDNFSWVIA SSKISNIHCIRKQSRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22370		ATUGT85A5	UDP-glucosyl transferase 85A5 ...		Lus10015747 [exp]	0	1
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10040325 [exp]	4.6	0.8441
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Lus10008073 [exp]	6.2	0.7434
AT4G34850		LAP5	LESS ADHESIVE POLLEN 5, Chalco...		Lus10042388 [exp]	13.4	0.7175
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	19.4	0.7251
AT2G25470		AtRLP21	receptor like protein 21 (.1)		Lus10027855 [exp]	22.4	0.7251
AT2G34320			Polynucleotidyl transferase, r...		Lus10039942 [exp]	25.1	0.7251
					Lus10043259 [exp]	25.9	0.6952
AT1G17930			Aminotransferase-like, plant m...		Lus10016922 [exp]	27.5	0.7251
AT3G02645			Plant protein of unknown funct...		Lus10015084 [exp]	27.8	0.6955
					Lus10021782 [exp]	29.7	0.7251

Compare expression of checked genes

Lus10015747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.