Lus10015748 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05680 120 / 8e-33 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT1G05675 118 / 7e-32 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31750 114 / 3e-30 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT2G36970 110 / 1e-28 UDP-Glycosyltransferase superfamily protein (.1)
AT2G43840 108 / 2e-28 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
AT1G07260 108 / 2e-28 UGT71C3 UDP-glucosyl transferase 71C3 (.1)
AT1G78270 108 / 4e-28 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
AT3G02100 108 / 5e-28 UDP-Glycosyltransferase superfamily protein (.1)
AT1G22380 108 / 5e-28 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1)
AT5G14860 107 / 1e-27 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003455 289 / 2e-97 AT3G02100 291 / 1e-93 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015749 268 / 5e-89 AT3G02100 274 / 6e-87 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015751 257 / 6e-85 AT3G02100 281 / 7e-90 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003454 255 / 5e-84 AT3G02100 268 / 1e-84 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015746 230 / 2e-74 AT3G02100 300 / 4e-97 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015745 221 / 7e-71 AT3G02100 288 / 1e-92 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003453 214 / 3e-68 AT3G02100 276 / 6e-88 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015744 209 / 1e-66 AT3G02100 271 / 6e-86 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015753 193 / 7e-60 AT3G02100 297 / 1e-95 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G084900 162 / 3e-48 AT3G02100 307 / 9e-100 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G091500 161 / 5e-48 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1)
Potri.004G123500 161 / 6e-48 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1)
Potri.004G119700 151 / 3e-44 AT3G02100 457 / 8e-159 UDP-Glycosyltransferase superfamily protein (.1)
Potri.013G022800 139 / 1e-39 AT3G02100 302 / 9e-98 UDP-Glycosyltransferase superfamily protein (.1)
Potri.005G073766 123 / 1e-33 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.005G073800 123 / 1e-33 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G105300 121 / 6e-33 AT1G22380 327 / 8e-107 UDP-glucosyl transferase 85A3 (.1)
Potri.016G105400 120 / 1e-32 AT1G22380 324 / 6e-106 UDP-glucosyl transferase 85A3 (.1)
Potri.007G095000 114 / 4e-30 AT1G22340 543 / 0.0 UDP-glucosyl transferase 85A7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10015748 pacid=23167618 polypeptide=Lus10015748 locus=Lus10015748.g ID=Lus10015748.BGIv1.0 annot-version=v1.0
ATGCCATTCCTTTGGGTGATCAGAACAGATTTTGTGATGCAAGGGTCGTCAGGTCTGGAGTTCCCAGATGGATACCTAGAGAGGGTTGTGAATCGGGGAA
AAATGGTGGAGTGGACGGATCAAGAGCAAGTGCTTTCTCACCCTTCTGTAGGGTGTTTCCTGAGTCATTGCAGATGGAACTCGACACTGGATGGGTTGTG
GTGCGGAGTTCCGTTTCTGTGTTGGCCTTACTTTGTGGATCAGTTCCATAAAAAGGAGGCTATATGTGAAGCTTGGAAAGTTGGTGTGAAACTGAAGGCT
GAAGAAGATGGAACTGCAGGATTGATCACCAAGTCTGAAATTGCCAACAAGGTTGAACAACTTCTTAATGATGATACCATAAAAGAGAATGCAAATAGGT
TGAGGGATGTTGCTAGGGAAACTGTGAAAGAGGGTGGCTCTTCGTTTCAGAGTTTATTTAGTATCATCAACCAATTATGTATTGGTTTGTGA
AA sequence
>Lus10015748 pacid=23167618 polypeptide=Lus10015748 locus=Lus10015748.g ID=Lus10015748.BGIv1.0 annot-version=v1.0
MPFLWVIRTDFVMQGSSGLEFPDGYLERVVNRGKMVEWTDQEQVLSHPSVGCFLSHCRWNSTLDGLWCGVPFLCWPYFVDQFHKKEAICEAWKVGVKLKA
EEDGTAGLITKSEIANKVEQLLNDDTIKENANRLRDVARETVKEGGSSFQSLFSIINQLCIGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Lus10015748 0 1
AT4G09990 Protein of unknown function (D... Lus10007374 4.0 0.6228
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10022696 7.7 0.6314
Lus10016844 7.9 0.6863
AT1G21270 WAK2 wall-associated kinase 2 (.1) Lus10013385 8.5 0.6492
Lus10019981 10.6 0.6947
AT3G03470 CYP89A9 "cytochrome P450, family 87, s... Lus10020354 11.3 0.5634
AT1G79500 ATKDSA1, KDSA Aldolase-type TIM barrel famil... Lus10027741 16.9 0.5984
AT2G26820 ATPP2-A3 phloem protein 2-A3 (.1) Lus10026891 17.1 0.6592
AT4G29530 Pyridoxal phosphate phosphatas... Lus10008573 24.1 0.6303
AT5G58380 PKS2, CIPK10, S... SNF1-RELATED PROTEIN KINASE 3.... Lus10030546 25.3 0.6431

Lus10015748 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.