Lus10015755 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53530 86 / 4e-22 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
AT1G23465 64 / 3e-13 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G29960 64 / 3e-13 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G08980 47 / 4e-07 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033448 124 / 4e-37 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10005571 119 / 1e-34 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10013703 117 / 5e-31 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Lus10025393 82 / 5e-20 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10036985 84 / 2e-19 AT2G44220 218 / 7e-65 Protein of Unknown Function (DUF239) (.1)
Lus10015272 49 / 2e-07 AT1G53530 111 / 4e-31 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10002492 48 / 2e-07 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10004822 47 / 5e-07 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G380400 95 / 3e-25 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.007G071400 81 / 1e-19 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.005G092900 75 / 3e-17 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.016G115100 48 / 2e-07 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
PFAM info
Representative CDS sequence
>Lus10015755 pacid=23167672 polypeptide=Lus10015755 locus=Lus10015755.g ID=Lus10015755.BGIv1.0 annot-version=v1.0
ATGATCGAACACTTGTCTCGCCGTTTGGACAAGGTTGAACCTGGAGACATTGTTCTAGTTCGATTCCCGGTCAAACCGGGAAAGATTCTGGCTAAATGGA
TAACCGGGATGGAAGGTGATCGCGTCACTTTCCTTCACATTCCAGTCCCAAAAGGCCATGTGTGGATTCAGCGGGAGAATGTGTATGCTACGGTTGATTC
GAAATATTTTAGTTCTGTTCTATCTGGTTTGATTCAAGAAAGAGCGTTTCTAATGATGAGTACAGAATCATGTCACCGCAGACTATTAATTGTTGTTCGG
GTGAATAGGTTGTTGGAAATAAGACTGAAAGTGGCGGTGGATGAGTTGTTGGTGTCGATGTGCTGGCTCAAGGTCGGAGGCTTCTGCTACTGTCACCGTC
TAGGTGCTGCAAGCGGCAATAGGAATGGGAGAAGGGATGATTACATTGAGACTAGAATATTGAGATTAGTAACTCGGTAA
AA sequence
>Lus10015755 pacid=23167672 polypeptide=Lus10015755 locus=Lus10015755.g ID=Lus10015755.BGIv1.0 annot-version=v1.0
MIEHLSRRLDKVEPGDIVLVRFPVKPGKILAKWITGMEGDRVTFLHIPVPKGHVWIQRENVYATVDSKYFSSVLSGLIQERAFLMMSTESCHRRLLIVVR
VNRLLEIRLKVAVDELLVSMCWLKVGGFCYCHRLGAASGNRNGRRDDYIETRILRLVTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Lus10015755 0 1

Lus10015755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.