Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48660 86 / 9e-24 Protein of unknown function (DUF 3339) (.1) AT5G63500 80 / 1e-21 Protein of unknown function (DUF 3339) (.1) AT5G40980 79 / 3e-21 Protein of unknown function (DUF 3339) (.1) AT5G08391 77 / 1e-20 Protein of unknown function (DUF 3339) (.1) AT3G27027 76 / 3e-20 Protein of unknown function (DUF 3339) (.1) AT3G27030 75 / 6e-19 unknown protein AT5G40970 67 / 1e-16 Protein of unknown function (DUF 3339) (.1) AT5G14110 66 / 4e-16 Protein of unknown function (DUF 3339) (.1) AT3G01950 65 / 5e-16 Protein of unknown function (DUF 3339) (.1) AT3G01940 58 / 5e-13 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037036 [exp] 101 / 4e-30 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 85 / 1e-23 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 84 / 4e-23 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10012542 [exp] 79 / 4e-21 AT3G27030 113 / 3e-34 unknown protein Lus10041551 [exp] 79 / 4e-21 AT3G27030 113 / 3e-34 unknown protein Lus10037035 [exp] 78 / 8e-21 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 77 / 1e-20 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10035199 [exp] 76 / 3e-20 AT3G27030 108 / 4e-32 unknown protein Lus10032030 [exp] 74 / 2e-19 AT3G27030 106 / 2e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 88 / 5e-25 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 79 / 2e-21 AT3G27030 111 / 2e-33 unknown protein Potri.001G329000 [exp] 79 / 2e-21 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 79 / 3e-21 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 79 / 3e-21 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 80 / 4e-21 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 78 / 7e-21 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 75 / 1e-19 AT3G27030 79 / 2e-20 unknown protein Potri.017G064301 [exp] 74 / 3e-19 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G058001 [exp] 72 / 1e-18 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10015769 pacid=23167641 polypeptide=Lus10015769 locus=Lus10015769.g ID=Lus10015769.BGIv1.0 annot-version=v1.0 ATGGCGGATTGGGGGCCGGTAGTGATAGCGGTGGTGCTGTTCGTACTGTTGACTCCAGGGTTGTTGTTCCAGCTACCTGGGAGAGACAGAGTGGTTGAGT TTGGGAAGATGCACACCAGTGGGATGTCCATATTAGTCCACACCATCATTTTCTTTGGACTCATCACCATCTTCTTGATCGCCATTGGAGTCCATATCAA CACTGGATGA
AA sequence Show only first row Show all	>Lus10015769 pacid=23167641 polypeptide=Lus10015769 locus=Lus10015769.g ID=Lus10015769.BGIv1.0 annot-version=v1.0 MADWGPVVIAVVLFVLLTPGLLFQLPGRDRVVEFGKMHTSGMSILVHTIIFFGLITIFLIAIGVHINTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48660			Protein of unknown function (D...		Lus10015769 [exp]	0	1
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Lus10021551 [exp]	4.9	0.8101
AT1G31550			GDSL-like Lipase/Acylhydrolase...		Lus10024085 [exp]	6.1	0.8409
AT3G52360			unknown protein		Lus10016198 [exp]	7.5	0.7918
AT3G47160			RING/U-box superfamily protein...		Lus10011390 [exp]	8.3	0.8268
AT1G23390			Kelch repeat-containing F-box ...		Lus10029127 [exp]	9.6	0.8330
AT2G32510		MAPKKK17	mitogen-activated protein kina...		Lus10035284 [exp]	10.2	0.8043
					Lus10038207 [exp]	12.0	0.8025
AT4G26080		AtABI1, ABI1	ABA INSENSITIVE 1, Protein pho...		Lus10012962 [exp]	12.2	0.8017
AT1G75810			unknown protein		Lus10033134 [exp]	12.4	0.8069
AT5G02090			unknown protein		Lus10024357 [exp]	12.5	0.8254

Compare expression of checked genes

Lus10015769 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.