Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) AT3G48660 103 / 5e-31 Protein of unknown function (DUF 3339) (.1) AT3G27030 102 / 1e-29 unknown protein AT5G63500 98 / 7e-29 Protein of unknown function (DUF 3339) (.1) AT3G27027 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) AT5G14110 87 / 1e-24 Protein of unknown function (DUF 3339) (.1) AT3G01950 87 / 1e-24 Protein of unknown function (DUF 3339) (.1) AT5G40980 78 / 4e-21 Protein of unknown function (DUF 3339) (.1) AT5G40970 78 / 5e-21 Protein of unknown function (DUF 3339) (.1) AT5G50660 66 / 2e-16 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037035 [exp] 138 / 7e-45 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 106 / 3e-32 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 104 / 1e-31 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10032032 [exp] 104 / 2e-31 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10035201 [exp] 104 / 2e-31 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 98 / 8e-29 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 96 / 3e-28 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10041551 [exp] 94 / 3e-27 AT3G27030 113 / 3e-34 unknown protein Lus10012542 [exp] 94 / 3e-27 AT3G27030 113 / 3e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170500 [exp] 125 / 1e-39 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 120 / 5e-38 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 117 / 2e-36 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 112 / 1e-34 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 102 / 1e-30 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 97 / 2e-28 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 91 / 3e-26 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 87 / 8e-25 AT3G27030 79 / 2e-20 unknown protein Potri.001G328701 [exp] 89 / 2e-24 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G058001 [exp] 87 / 2e-24 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10015770 pacid=23167713 polypeptide=Lus10015770 locus=Lus10015770.g ID=Lus10015770.BGIv1.0 annot-version=v1.0 ATGTCGGACTGGGGCCCAGTGTTTGTGGCGATGGTGCTGTTCGTGCTGTTAACACCAGGGCTGTTGTTTCAGGTGCCAGGTCGAAACCGCTGCATCGAGT TTGGGAATTTCCAGACAAGTGGCGCCGCCATTCTCATCCATTCACTTCTCTACTTTGCCCTCGTCTGCGTCTTCTTGCTTGCTATTAAGGTTCATTTTTA TCTTGGTTAA
AA sequence Show only first row Show all	>Lus10015770 pacid=23167713 polypeptide=Lus10015770 locus=Lus10015770.g ID=Lus10015770.BGIv1.0 annot-version=v1.0 MSDWGPVFVAMVLFVLLTPGLLFQVPGRNRCIEFGNFQTSGAAILIHSLLYFALVCVFLLAIKVHFYLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08391			Protein of unknown function (D...		Lus10015770 [exp]	0	1
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10012893 [exp]	10.9	0.8000
AT2G28200	C2H2ZnF		C2H2-type zinc finger family p...		Lus10038674 [exp]	11.0	0.7968
AT2G38750		ANNAT4	annexin 4 (.1)		Lus10024171 [exp]	33.8	0.7940
					Lus10022042 [exp]	40.6	0.7588
AT1G54730			Major facilitator superfamily ...		Lus10029963 [exp]	62.6	0.7381
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021938 [exp]	69.1	0.7517
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10032218 [exp]	70.0	0.7369
AT2G22590			UDP-Glycosyltransferase superf...		Lus10025711 [exp]	100.4	0.7214
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031677 [exp]	112.2	0.7271
AT5G35740			Carbohydrate-binding X8 domain...		Lus10012324 [exp]	113.3	0.7289

Compare expression of checked genes

Lus10015770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.