Lus10015772 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27310 189 / 4e-63 NTF2A nuclear transport factor 2A (.1)
AT1G27970 181 / 4e-60 NTF2B nuclear transport factor 2B (.1.2)
AT1G11570 120 / 8e-36 NTL NTF2-like (.1.2)
AT5G48650 40 / 0.0002 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT5G60980 38 / 0.001 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037033 207 / 3e-70 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2)
Lus10032033 192 / 2e-64 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2)
Lus10035202 189 / 2e-63 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1)
Lus10020061 115 / 9e-34 AT1G11570 171 / 3e-56 NTF2-like (.1.2)
Lus10006762 113 / 2e-33 AT1G11570 130 / 2e-40 NTF2-like (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G057500 188 / 6e-63 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2)
Potri.003G170800 185 / 1e-61 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2)
Potri.011G025500 126 / 4e-38 AT1G11570 171 / 5e-56 NTF2-like (.1.2)
Potri.010G157800 42 / 5e-05 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Potri.008G096700 41 / 7e-05 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Potri.017G094600 40 / 0.0001 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.002G246600 39 / 0.0006 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0051 NTF2 PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence
>Lus10015772 pacid=23167669 polypeptide=Lus10015772 locus=Lus10015772.g ID=Lus10015772.BGIv1.0 annot-version=v1.0
ATGAATCCAGACGCAGTGGCCAAGGCATTCGTAGATCACTACTACAGTACTTTCGACACCAACCGAGCTGGACTGGCTAACCTTTACCAGGATGGCTCCA
TGCTCACCTTCGAAGGCCAGCAGATCCAGGGCTCCCAAAACATAGTCGCTAAGCTTACGAGCCTTCCTTTCCAGCAGTGCCAGCACAGCATCACCACCGT
CGATTGCCAGCCCTCTGGTCCTGCCGGCGGGATGCTTGTCTTCGTCTCTGGTAACCTCCAGCTCTCCGGGGAACAGCATGCTCTCAAGTTTAGCCAGGTC
ATATTGAAGAACAATGCGGATTTCTTACTAGTTGTGATATCAGATCTTACAATTTGTTTTTGCGACCTCGAGATCTCGGATCTTATGTCTAGCTTTGCAA
GCTTCGATAAATGA
AA sequence
>Lus10015772 pacid=23167669 polypeptide=Lus10015772 locus=Lus10015772.g ID=Lus10015772.BGIv1.0 annot-version=v1.0
MNPDAVAKAFVDHYYSTFDTNRAGLANLYQDGSMLTFEGQQIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLSGEQHALKFSQV
ILKNNADFLLVVISDLTICFCDLEISDLMSSFASFDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27310 NTF2A nuclear transport factor 2A (.... Lus10015772 0 1
AT3G24860 Trihelix Homeodomain-like superfamily p... Lus10011851 6.2 0.8375
AT5G67260 CYCD3;2 CYCLIN D3;2 (.1) Lus10019317 6.9 0.8022
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10026839 8.8 0.8339
AT5G28040 GeBP DNA-binding storekeeper protei... Lus10015944 10.0 0.8372
AT3G55780 Glycosyl hydrolase superfamily... Lus10028258 12.0 0.7968
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Lus10003887 12.2 0.7953
AT3G05545 RING/U-box superfamily protein... Lus10029886 15.1 0.7872
AT4G10810 unknown protein Lus10023038 17.5 0.8178
AT1G65270 unknown protein Lus10020224 17.5 0.7904
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10030436 17.5 0.8247

Lus10015772 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.