Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27950 127 / 2e-37 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT2G44290 69 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 66 / 1e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 50 / 6e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 50 / 1e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G03103 48 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G58550 48 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 48 / 5e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G73890 47 / 9e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037027 [exp] 228 / 4e-77 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10006413 [exp] 149 / 1e-45 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10011358 [exp] 134 / 3e-40 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10017749 [exp] 71 / 3e-15 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 68 / 3e-14 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 59 / 2e-10 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10014681 [exp] 57 / 3e-10 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 55 / 1e-09 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 54 / 4e-09 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G056200 [exp] 150 / 3e-46 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.003G172400 [exp] 146 / 9e-45 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.001G232000 [exp] 71 / 3e-15 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 55 / 1e-09 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 54 / 2e-09 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 54 / 3e-09 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G053700 [exp] 52 / 2e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 52 / 2e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 51 / 3e-08 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 50 / 5e-08 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10015779 pacid=23167690 polypeptide=Lus10015779 locus=Lus10015779.g ID=Lus10015779.BGIv1.0 annot-version=v1.0 ATGCAGAGATTTGTGGTTGTGATACTGAGCATATGCATGGCGGCCGTGATGGTGGCGCCGTTGGCCATGGTGGCGGGAGAGAACTTGAGTACAGAGTGCG CAAAGGACTTCCAGAGCGTGATGACTTGCTTAGCCTACGCACAGGGGAAGCAGACCACTCCTTCCAAAGAATGCTGCGACTCCGTCAAGAACATCAACAG CAACGAGCCCAAGTGCCTCTGCTACATCATGCAGGAGACTCACAACGGCAGCGCTCAGTTCAAGAGCATGGGCATCCAGGAGTCCAAACTCCTTCAGCTC CCAACTGCCTGCCAGCTCCACAACGCTACCGTCTCCTTCTGCCCACGTCTGCTTGGTTTGCCTCCCAACTCGCCAGACGCTGCCATTTTCAGCAACGCTT CCTCCGCCTCATCGGCTTCTCCGACCACATCGATGGTTACTACTACGCCACTGCCGGAGACTTCTGGGGGATTTCGTGACGTGGCCGGGTTGTCCTTGGT CGTCACTGTTGTTGTGTTCTCCGTTTTCAGTGTCTAG
AA sequence Show only first row Show all	>Lus10015779 pacid=23167690 polypeptide=Lus10015779 locus=Lus10015779.g ID=Lus10015779.BGIv1.0 annot-version=v1.0 MQRFVVVILSICMAAVMVAPLAMVAGENLSTECAKDFQSVMTCLAYAQGKQTTPSKECCDSVKNINSNEPKCLCYIMQETHNGSAQFKSMGIQESKLLQL PTACQLHNATVSFCPRLLGLPPNSPDAAIFSNASSASSASPTTSMVTTTPLPETSGGFRDVAGLSLVVTVVVFSVFSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10015779 [exp]	0	1
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10030723 [exp]	1.0	0.9769
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10037027 [exp]	2.4	0.9651
AT1G44760			Adenine nucleotide alpha hydro...		Lus10018190 [exp]	3.2	0.9598
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10021408 [exp]	3.7	0.9572
AT3G13960	GRF	ATGRF5	growth-regulating factor 5 (.1...		Lus10000473 [exp]	6.0	0.9607
AT1G68480	C2H2ZnF	JAG	JAGGED, C2H2 and C2HC zinc fin...		Lus10041443 [exp]	9.0	0.9618
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10026076 [exp]	9.2	0.9598
AT5G45650			subtilase family protein (.1)		Lus10007083 [exp]	9.2	0.9386
AT3G58530			RNI-like superfamily protein (...		Lus10012294 [exp]	11.7	0.9426
AT3G63300		FKD1	FORKED 1 (.1.2)		Lus10004079 [exp]	12.2	0.9474

Compare expression of checked genes

Lus10015779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.