Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43260 93 / 4e-26 chaperone protein dnaJ-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037022 [exp] 142 / 8e-46 AT5G43260 135 / 4e-43 chaperone protein dnaJ-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G171800 [exp] 87 / 5e-24 AT5G43260 152 / 1e-49 chaperone protein dnaJ-related (.1) Potri.001G056601 [exp] 81 / 1e-21 AT5G43260 145 / 4e-47 chaperone protein dnaJ-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015783 pacid=23167678 polypeptide=Lus10015783 locus=Lus10015783.g ID=Lus10015783.BGIv1.0 annot-version=v1.0 ATGGTGCCGATGGTGTTGACCGGAATCAGCGTGCTCGCCGGGGCGGCGGTGGCGAAGTCGTTGCTGGAGCAGAAGCCCATGTCGAGTCAGTTCCAGCCCA GGTGCCCATCCTGCAACGGAACGGGTCGGGTCGAATGCATGTGTTCCAGGTGGTCGGACGGAGACGTGGGTTGTCGGAGCTGCGCCGGGTCAGGGCGGAC GGGCTGCAGCAGCTGTGGCGGGTCGGGGACTGGGAGGCCTCTTCCGGTTCAAATCAGGATGCAGTCGCCAAACCGATATGGGTCGGATTAA
AA sequence Show only first row Show all	>Lus10015783 pacid=23167678 polypeptide=Lus10015783 locus=Lus10015783.g ID=Lus10015783.BGIv1.0 annot-version=v1.0 MVPMVLTGISVLAGAAVAKSLLEQKPMSSQFQPRCPSCNGTGRVECMCSRWSDGDVGCRSCAGSGRTGCSSCGGSGTGRPLPVQIRMQSPNRYGSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43260			chaperone protein dnaJ-related...		Lus10015783 [exp]	0	1
AT2G35200			unknown protein		Lus10036051 [exp]	1.4	0.8431
AT1G76570			Chlorophyll A-B binding family...		Lus10005421 [exp]	2.0	0.8313
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10026986 [exp]	3.5	0.8262
AT5G48545		HINT3	histidine triad nucleotide-bin...		Lus10025883 [exp]	4.0	0.8157
AT3G57450			unknown protein		Lus10019730 [exp]	4.1	0.7644
AT1G12440			A20/AN1-like zinc finger famil...		Lus10006671 [exp]	7.0	0.7872
AT5G42440			Protein kinase superfamily pro...		Lus10015344 [exp]	7.1	0.7953
AT5G01410		PDX1, ATPDX1.3,...	REDUCED SUGAR RESPONSE 4, ARAB...		Lus10002486 [exp]	8.4	0.7707
AT1G63900		DAL1	DIAP1-like protein 1, E3 Ubiqu...		Lus10008163 [exp]	9.4	0.7758
AT1G48320			Thioesterase superfamily prote...		Lus10006220 [exp]	11.3	0.7645

Compare expression of checked genes

Lus10015783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.