Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67350 146 / 2e-47 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037020 [exp] 197 / 9e-67 AT1G67350 145 / 7e-46 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G055400 [exp] 159 / 9e-53 AT1G67350 152 / 8e-50 unknown protein Potri.003G173000 [exp] 157 / 1e-51 AT1G67350 149 / 2e-48 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015785 pacid=23167698 polypeptide=Lus10015785 locus=Lus10015785.g ID=Lus10015785.BGIv1.0 annot-version=v1.0 ATGGGATTCATCAAGGAGTTTGCGGAGAATTTGATCCTGAGGTTGATGGAGGATCCCAAGGAGAGGGACAAGAACTTCAGGGATCATTTGTACTCGATGA AGGATCGTTGCAAGAAGACGAAGGAGATGTGGAGCTATCCACTCCGCCCTTACGGATTCTGGACGTTCGATCGCCACAACGCTCAGCTGTTCTGGGATGC TCAGATTAGTCAGGTAGCCGGCCGGAGGGACCCCTATGATGACATTCTGCAGGACCTCGGTGGGCCCAAGAGCCCCAAGTGA
AA sequence Show only first row Show all	>Lus10015785 pacid=23167698 polypeptide=Lus10015785 locus=Lus10015785.g ID=Lus10015785.BGIv1.0 annot-version=v1.0 MGFIKEFAENLILRLMEDPKERDKNFRDHLYSMKDRCKKTKEMWSYPLRPYGFWTFDRHNAQLFWDAQISQVAGRRDPYDDILQDLGGPKSPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67350			unknown protein		Lus10015785 [exp]	0	1
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10015714 [exp]	1.4	0.8601
AT5G54855			Pollen Ole e 1 allergen and ex...		Lus10019622 [exp]	1.7	0.8400
AT1G71180			6-phosphogluconate dehydrogena...		Lus10001349 [exp]	4.5	0.8458
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10000044 [exp]	6.2	0.7998
AT4G25570		ACYB-2	Cytochrome b561/ferric reducta...		Lus10038866 [exp]	6.6	0.8213
					Lus10014600 [exp]	6.7	0.8201
AT1G01170			Protein of unknown function (D...		Lus10042373 [exp]	8.7	0.7875
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10032532 [exp]	8.8	0.8172
AT1G55460	C2H2ZnF		DNA/RNA-binding protein Kin17,...		Lus10005161 [exp]	11.0	0.8063
AT3G02910			AIG2-like (avirulence induced ...		Lus10040635 [exp]	12.0	0.8051

Compare expression of checked genes

Lus10015785 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.