Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G40042 107 / 1e-31 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) AT2G22425 96 / 2e-27 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037014 [exp] 136 / 5e-43 AT4G40042 131 / 2e-41 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10037011 [exp] 134 / 2e-42 AT4G40042 127 / 1e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10011365 [exp] 67 / 1e-15 AT4G40042 75 / 2e-19 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10006422 [exp] 57 / 3e-12 AT4G40042 66 / 1e-15 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G175775 [exp] 111 / 3e-33 AT2G22425 124 / 1e-38 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2) Potri.010G059300 [exp] 105 / 5e-31 AT4G40042 119 / 7e-37 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06645 [flax] [poplar] SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12)
Representative CDS sequence Show only first row Show all	>Lus10015793 pacid=23167694 polypeptide=Lus10015793 locus=Lus10015793.g ID=Lus10015793.BGIv1.0 annot-version=v1.0 ATGGATTGGCAAGGGCAGAAGGTGGCGGAGCAGCTGGTGCAGCTGATGCTGCTGGCCTTAGCGGCGATCGGATTCGTCTCCGGATACATCACGGGATCGT TCCAGACCATGATCTTGATCTACGCCGGCGGAGTGGTTCTCACCGCGCTGACCGTCGTCCCGAACTGGCCTTGCTTCAATCGCCACCCTCTCCGGTGGCT GGATCCCCTCGAGGTCGAGAAGCACCCCAAGCCAGCTCAGACCGTCGCCTCCGCTGCTGCTTCTTCTTCCAAGATGAGCAAAGCTACGAAGTACGGTTTC TCTTGCTTAAGCTCTGATTCAAGCGTTTAG
AA sequence Show only first row Show all	>Lus10015793 pacid=23167694 polypeptide=Lus10015793 locus=Lus10015793.g ID=Lus10015793.BGIv1.0 annot-version=v1.0 MDWQGQKVAEQLVQLMLLALAAIGFVSGYITGSFQTMILIYAGGVVLTALTVVPNWPCFNRHPLRWLDPLEVEKHPKPAQTVASAAASSSKMSKATKYGF SCLSSDSSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40042			Microsomal signal peptidase 12...		Lus10015793 [exp]	0	1
AT2G27510		ATFD3	ferredoxin 3 (.1)		Lus10034144 [exp]	1.0	0.9324
AT2G42910			Phosphoribosyltransferase fami...		Lus10010935 [exp]	2.6	0.9030
AT4G33410		ATSPPL1	SIGNAL PEPTIDE PEPTIDASE-LIKE ...		Lus10027484 [exp]	4.7	0.8971
AT1G07890		ATAPX01, CS1, A...	maternal effect embryo arrest ...		Lus10013537 [exp]	5.3	0.9238
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Lus10030497 [exp]	5.5	0.9196
AT3G43520			Transmembrane proteins 14C (.1...		Lus10027640 [exp]	5.5	0.9226
AT1G68140			Protein of unknown function (D...		Lus10004940 [exp]	6.0	0.8970
AT1G70730		PGM2	phosphoglucomutase 2, Phosphog...		Lus10034595 [exp]	7.1	0.9005
AT3G56490		HIT3, HINT1	HISTIDINE TRIAD NUCLEOTIDE-BIN...		Lus10031011 [exp]	8.1	0.9112
AT2G20940			Protein of unknown function (D...		Lus10025069 [exp]	8.7	0.8926

Compare expression of checked genes

Lus10015793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.