Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037007 [exp] 183 / 9e-62 ND / Lus10006424 [exp] 110 / 1e-32 ND / Lus10011367 [exp] 105 / 6e-31 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G058400 [exp] 94 / 6e-26 ND / Potri.008G176700 [exp] 72 / 2e-17 ND / Potri.010G058600 [exp] 53 / 3e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015798 pacid=23167695 polypeptide=Lus10015798 locus=Lus10015798.g ID=Lus10015798.BGIv1.0 annot-version=v1.0 ATGGATAGCATGAAAGACATCAATGTAACTGCGGCAAGGGGGGCTAGGAGCTTCCGCAACGAGGGTTACAGCTACAGGAGGGTGTTTCTGAGGAGCTATC CGCTTCATTGGGAAGCAGATGACGACACAAGTTACGAAGAAGAAGACATGATCCGGTCTACAGACGAGCATGATCAGAAGAAACTCATGAAGAAGATGAT GCGGTCGATGTTTCAGTGGGGGGAAGCTAGGGTTCTGGTTTTGAGGAGATTCAAGCATAAGGTTAGAGTTTACGTCGTAAGTCGTATCCTTGTTGGCTAC TAG
AA sequence Show only first row Show all	>Lus10015798 pacid=23167695 polypeptide=Lus10015798 locus=Lus10015798.g ID=Lus10015798.BGIv1.0 annot-version=v1.0 MDSMKDINVTAARGARSFRNEGYSYRRVFLRSYPLHWEADDDTSYEEEDMIRSTDEHDQKKLMKKMMRSMFQWGEARVLVLRRFKHKVRVYVVSRILVGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015798 [exp]	0	1
AT4G15050			Protein of Unknown Function (D...		Lus10002231 [exp]	6.9	0.8137
AT3G05610			Plant invertase/pectin methyle...		Lus10015211 [exp]	6.9	0.9025
AT3G14880			unknown protein		Lus10039196 [exp]	9.8	0.8949
AT1G76520			Auxin efflux carrier family pr...		Lus10013200 [exp]	12.2	0.8930
AT5G60010			ferric reductase-like transmem...		Lus10019390 [exp]	14.1	0.8927
AT1G04670			unknown protein		Lus10004041 [exp]	15.8	0.8927
					Lus10006918 [exp]	17.3	0.8927
					Lus10007508 [exp]	18.7	0.8927
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10037323 [exp]	19.4	0.7530
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10038344 [exp]	20.0	0.8884

Compare expression of checked genes

Lus10015798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.