Lus10015803 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 67 / 3e-14 Cysteine proteinases superfamily protein (.1)
AT2G27350 45 / 5e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT1G50670 44 / 1e-05 OTU-like cysteine protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037002 293 / 2e-103 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10020438 224 / 6e-74 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 177 / 6e-56 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840 178 / 4e-55 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027758 54 / 5e-09 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10005193 47 / 1e-06 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 41 / 0.0001 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G177400 242 / 2e-83 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G050900 226 / 2e-74 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400 216 / 1e-70 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 185 / 1e-58 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300 184 / 3e-58 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 74 / 7e-17 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.010G057750 60 / 1e-12 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.009G160100 48 / 5e-07 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.004G196800 42 / 0.0001 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 40 / 0.0002 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10015803 pacid=23167658 polypeptide=Lus10015803 locus=Lus10015803.g ID=Lus10015803.BGIv1.0 annot-version=v1.0
ATGGATTTTGGGTTAGGTTGGTTCTTGGATTTCTGGATACCAGGAGATGGCAGGTGCTTGTTCAGGTCCGTAGCTCATGGCGCTTGCCTTAGAGCGGGGA
AGCCATCCCCTAGCGAAACCGTCGAGAAAGAACTTGCTGATGAGCTCAGAGATGAGGTTGCTGACGAGTTCATCAAGAGAAGGAAGGAGACTGAATGGTT
CATTGAGGATGATTTTGATGAATATGTTGGACACATGAGACAGCCTCATGTCTGGGGAGGAGAGCCTGAGCTACTCATGTCCTCTCATGTCCTAAAGACG
CCGATCTCAGTTTACATGAAGGATAAGAGCTCCGGAACCCTGAAGGTTATAGCAGAATACGGCCAAGAGTATGGCAAGGATGTCCCGATTCGTGTTCTGT
ACCATGGTTATGGCCATTACGATGCTCTTCGAAGCTCGGTGTCCAGTTCGGAATCAAAACAGTGA
AA sequence
>Lus10015803 pacid=23167658 polypeptide=Lus10015803 locus=Lus10015803.g ID=Lus10015803.BGIv1.0 annot-version=v1.0
MDFGLGWFLDFWIPGDGRCLFRSVAHGACLRAGKPSPSETVEKELADELRDEVADEFIKRRKETEWFIEDDFDEYVGHMRQPHVWGGEPELLMSSHVLKT
PISVYMKDKSSGTLKVIAEYGQEYGKDVPIRVLYHGYGHYDALRSSVSSSESKQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57810 Cysteine proteinases superfami... Lus10015803 0 1
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10037992 2.2 0.9003
AT1G19270 DA1 DA1 (.1) Lus10018789 6.2 0.8812
AT5G04410 NAC NAC2, ANAC078 Arabidopsis NAC domain contain... Lus10032724 8.5 0.8780
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10042328 9.5 0.8813
AT3G08840 D-alanine--D-alanine ligase fa... Lus10012211 12.8 0.8789
AT3G17700 ATCNGC20, CNBT1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10031891 21.0 0.8676
AT5G26610 D111/G-patch domain-containing... Lus10001513 21.2 0.8698
AT3G05010 Protein of unknown function, t... Lus10018985 22.2 0.8649
AT1G14820 Sec14p-like phosphatidylinosit... Lus10003699 24.2 0.8371
AT4G24400 ATCIPK8, PKS11,... SNF1-RELATED PROTEIN KINASE 3.... Lus10032822 27.7 0.8766

Lus10015803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.