Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08530 213 / 4e-68 CI51 51 kDa subunit of complex I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036999 [exp] 228 / 5e-75 AT5G08530 632 / 0.0 51 kDa subunit of complex I (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G057400 [exp] 221 / 1e-71 AT5G08530 866 / 0.0 51 kDa subunit of complex I (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10589 [flax] [poplar] NADH_4Fe-4S NADH-ubiquinone oxidoreductase-F iron-sulfur binding region
Representative CDS sequence Show only first row Show all	>Lus10015807 pacid=23167638 polypeptide=Lus10015807 locus=Lus10015807.g ID=Lus10015807.BGIv1.0 annot-version=v1.0 ATGGACTATGATGCACTTAAGGCCGTCACATCAGGATTGGGAACCGCAGCTGTGATCGTGATGGACAAATCGACCGATATCGTCGATGCGATCGCGAGGT TGTCTTACTTCTACAAGCACGAGAGCTGCGGGCAGTGCACTCCGTGCAGAGAAGGCACTCCCTGGTTGTGGATGATGATGGAAAGATTGAAGGTTGGAAA TGCTAAGTTGGAAGAGATCGATATGCTTCAGGAACTCACCAAGCAGATTGAAGGGCACACAATTTGTGCTCTTGGTGATGCCGCAGCTTGGCCTGTACAG GGTCTTATTAGACATTTCAGGCCAGAGCTTGAGAGAAGGATCAGGGAGCGTGCCGACAGGGAGTTGTTGGAGGCTGCTGCTTAA
AA sequence Show only first row Show all	>Lus10015807 pacid=23167638 polypeptide=Lus10015807 locus=Lus10015807.g ID=Lus10015807.BGIv1.0 annot-version=v1.0 MDYDALKAVTSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTPWLWMMMERLKVGNAKLEEIDMLQELTKQIEGHTICALGDAAAWPVQ GLIRHFRPELERRIRERADRELLEAAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08530		CI51	51 kDa subunit of complex I (....		Lus10015807 [exp]	0	1
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009027 [exp]	2.0	0.8971
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10012501 [exp]	2.4	0.8601
AT1G70000	MYB		myb-like transcription factor ...		Lus10010733 [exp]	3.2	0.8841
AT1G70230		AXY4, TBL27	ALTERED XYLOGLUCAN 4, TRICHOME...		Lus10029188 [exp]	4.0	0.8639
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10022671 [exp]	5.0	0.8633
AT1G03350			BSD domain-containing protein ...		Lus10042670 [exp]	5.7	0.8690
AT1G09960		ATSUC4, SUC4, A...	sucrose transporter 4 (.1)		Lus10032815 [exp]	7.7	0.8457
AT1G57680			unknown protein		Lus10008842 [exp]	7.9	0.8252
AT5G11810			unknown protein		Lus10022300 [exp]	8.1	0.8454
AT4G17080			Histone H3 K4-specific methylt...		Lus10042858 [exp]	8.5	0.8230

Compare expression of checked genes

Lus10015807 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.