Lus10015815 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20480 154 / 3e-44 AMP-dependent synthetase and ligase family protein (.1)
AT1G20510 148 / 1e-42 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT1G20500 143 / 3e-40 AMP-dependent synthetase and ligase family protein (.1)
AT5G63380 141 / 1e-39 AMP-dependent synthetase and ligase family protein (.1)
AT5G38120 129 / 2e-35 4CL8 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 117 / 5e-31 AMP-dependent synthetase and ligase family protein (.1)
AT3G21240 107 / 4e-27 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1)
AT4G19010 102 / 1e-25 AMP-dependent synthetase and ligase family protein (.1)
AT3G21230 100 / 7e-25 4CL5 4-coumarate:CoA ligase 5 (.1)
AT1G65060 87 / 2e-20 4CL3 4-coumarate:CoA ligase 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036994 258 / 3e-84 AT5G63380 516 / 4e-179 AMP-dependent synthetase and ligase family protein (.1)
Lus10015998 132 / 4e-36 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10012280 131 / 1e-35 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10037934 130 / 1e-35 AT1G20510 462 / 2e-157 OPC-8:0 CoA ligase1 (.1.2)
Lus10038667 130 / 1e-35 AT1G20510 449 / 1e-152 OPC-8:0 CoA ligase1 (.1.2)
Lus10013831 130 / 2e-35 AT4G05160 654 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10015999 130 / 2e-35 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10026544 129 / 5e-35 AT4G05160 642 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10021431 126 / 4e-34 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G033600 174 / 8e-52 AT5G63380 598 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.010G057000 163 / 6e-48 AT5G63380 530 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G094800 150 / 5e-43 AT5G63380 657 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.015G092300 144 / 7e-41 AT5G63380 594 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.002G012800 142 / 5e-40 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.012G095000 142 / 7e-40 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.005G248500 142 / 8e-40 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.012G094900 139 / 6e-39 AT5G63380 604 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.008G031500 129 / 5e-35 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2)
Potri.010G230200 127 / 1e-34 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10015815 pacid=23167624 polypeptide=Lus10015815 locus=Lus10015815.g ID=Lus10015815.BGIv1.0 annot-version=v1.0
ATGGATAGAATCGAATTGAAGAAGATGCTGAAAGCAATTCAGGAACATCGTGTTAGGCACGTGGCGGCAGCTCCGCCGCTCGTAATATCTCTGATCAACG
AAGATCGGAAGGTGGTCGCCGGCTACGATTTGAGCTCCCTCGAAGTTGTAGCCTGCGGTGGCGCCCTACTGGGAAGAGATGCAGCCACGCTCTTTACCAA
GCTGTTTCCAAGTGCTCTGCTCGTCCAGAATCTTTATCCTGATGGGACAAGGATTCTGGTTCCTGTAATGATGCTTGCAGGCTATGTTGGTGACGAGGAA
GCAACTGCTAAGGCTTTGGATTCGGAAGGATGGCTGAGAACTGGAGACCTCTGCTACATTGACGACCAAGGGTTCCTTTTTATGGTCGACAGGATCAAGG
AACTGATCAAATGCAGAGGCTATCAGGTAGCTCCAGCTGAGCTTGAGCATTTGCTTCAGTCACATCCAGAAATTCTCGAGGCAGCAGTCGTCCTGCCAAG
TTCCGGTGGCGTTCATGGCAAGGCAGAATGGAAGCACCATGAGTGA
AA sequence
>Lus10015815 pacid=23167624 polypeptide=Lus10015815 locus=Lus10015815.g ID=Lus10015815.BGIv1.0 annot-version=v1.0
MDRIELKKMLKAIQEHRVRHVAAAPPLVISLINEDRKVVAGYDLSSLEVVACGGALLGRDAATLFTKLFPSALLVQNLYPDGTRILVPVMMLAGYVGDEE
ATAKALDSEGWLRTGDLCYIDDQGFLFMVDRIKELIKCRGYQVAPAELEHLLQSHPEILEAAVVLPSSGGVHGKAEWKHHE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10015815 0 1
AT5G03770 AtKdtA, KDTA KDO transferase A (.1) Lus10017662 3.2 0.6828
AT1G48820 Terpenoid cyclases/Protein pre... Lus10008613 20.0 0.6804
AT5G42510 Disease resistance-responsive ... Lus10000376 25.0 0.6663
AT1G27680 APL2 ADPGLC-PPase large subunit (.1... Lus10007209 55.7 0.6276
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10007044 75.7 0.6003
Lus10029490 79.5 0.6070
AT1G01760 adenosine deaminases;RNA bindi... Lus10017815 94.9 0.5525
AT3G19950 RING/U-box superfamily protein... Lus10033682 97.5 0.6147
AT4G01575 serine protease inhibitor, Kaz... Lus10010287 126.6 0.5952
AT3G20050 ATTCP-1 T-complex protein 1 alpha subu... Lus10036714 128.6 0.5857

Lus10015815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.