Lus10015828 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004853 172 / 3e-53 ND /
Lus10004851 84 / 1e-19 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1)
Lus10011048 76 / 1e-16 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1)
Lus10004852 75 / 2e-16 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1)
Lus10026712 74 / 2e-16 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2)
Lus10020638 68 / 4e-15 AT1G13570 37 / 0.002 F-box/RNI-like superfamily protein (.1)
Lus10003016 69 / 3e-14 AT1G13570 81 / 1e-16 F-box/RNI-like superfamily protein (.1)
Lus10004849 65 / 4e-13 ND 41 / 6e-04
Lus10020637 53 / 5e-09 AT3G58940 47 / 3e-06 F-box/RNI-like superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015828 pacid=23163294 polypeptide=Lus10015828 locus=Lus10015828.g ID=Lus10015828.BGIv1.0 annot-version=v1.0
ATGGCAACAGTAGAGGCTCAATATGTTGGAGGTGATCAGAAGCCATGGAAGAAGCTGAAGCATATGCAGTTGAATGGATTGGATATGAGTCAAAGGTTTC
ATGCTTGTAGGGTTCTTCATGTGATGAACAGTTCTCCGAATTTGCAACGACTTGCAATAATCATGAGTTCCAGTGACAGGGAAGCTCTGGAGATAATGAA
ATCTGAAGTTGCTCCTTCCGAATTCCAACGGCTGAAGAGGATTGAGTTGGAAAATGTAGGAGGTACAGATGATGAACTGACTCTGATCAGCTGGCTGTTG
AACTCATCTTCAGCACTTGAACAGATGAAAATCCAGTTTCCCACTACTGAGCTATCCCATGACTATGAAAAATTGCGGTTTGTGAATTTGGTGGATGGGT
TTCATAGGGCTTCAAACACTGCACATATTACGTATGTAAAATGTATTTAA
AA sequence
>Lus10015828 pacid=23163294 polypeptide=Lus10015828 locus=Lus10015828.g ID=Lus10015828.BGIv1.0 annot-version=v1.0
MATVEAQYVGGDQKPWKKLKHMQLNGLDMSQRFHACRVLHVMNSSPNLQRLAIIMSSSDREALEIMKSEVAPSEFQRLKRIELENVGGTDDELTLISWLL
NSSSALEQMKIQFPTTELSHDYEKLRFVNLVDGFHRASNTAHITYVKCI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015828 0 1
AT5G15430 Plant calmodulin-binding prote... Lus10003472 1.0 0.9981
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10028145 1.4 0.9950
AT2G03200 Eukaryotic aspartyl protease f... Lus10022917 2.4 0.9926
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10002933 2.8 0.9846
AT1G11340 S-locus lectin protein kinase ... Lus10036139 3.5 0.9911
AT5G15430 Plant calmodulin-binding prote... Lus10000141 3.9 0.9899
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040326 4.2 0.9838
AT1G49490 Leucine-rich repeat (LRR) fami... Lus10027935 4.5 0.9814
Lus10000028 4.9 0.9738
Lus10006075 5.3 0.9670

Lus10015828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.