Lus10015837 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20823 61 / 5e-12 RING/U-box superfamily protein (.1)
AT1G76410 59 / 1e-11 ATL8 RING/U-box superfamily protein (.1)
AT5G42200 58 / 3e-11 RING/U-box superfamily protein (.1)
AT3G03550 58 / 1e-10 RING/U-box superfamily protein (.1)
AT1G53010 57 / 1e-10 RING/U-box superfamily protein (.1)
AT5G17600 57 / 2e-10 RING/U-box superfamily protein (.1)
AT1G72220 57 / 2e-10 RING/U-box superfamily protein (.1)
AT5G01880 56 / 2e-10 RING/U-box superfamily protein (.1)
AT5G05280 56 / 2e-10 RING/U-box superfamily protein (.1)
AT4G35480 56 / 3e-10 RHA3B RING-H2 finger A3B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009326 188 / 9e-63 AT3G03550 61 / 1e-11 RING/U-box superfamily protein (.1)
Lus10033425 60 / 6e-12 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1)
Lus10006785 60 / 1e-11 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10022223 59 / 2e-11 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10030728 59 / 2e-11 AT1G20823 209 / 6e-69 RING/U-box superfamily protein (.1)
Lus10036380 59 / 2e-11 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
Lus10029456 57 / 2e-11 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1)
Lus10029037 58 / 3e-11 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10008972 58 / 4e-11 AT5G06490 76 / 2e-17 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G206200 62 / 9e-13 AT5G17600 91 / 6e-22 RING/U-box superfamily protein (.1)
Potri.001G159300 61 / 2e-12 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.003G075200 61 / 3e-12 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Potri.005G099000 60 / 9e-12 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.007G064401 59 / 3e-11 AT1G20823 118 / 2e-33 RING/U-box superfamily protein (.1)
Potri.005G255200 57 / 8e-11 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1)
Potri.001G127100 58 / 1e-10 AT5G45290 286 / 2e-89 RING/U-box superfamily protein (.1.2)
Potri.007G057300 56 / 1e-10 AT2G17450 66 / 1e-13 RING-H2 finger A3A (.1)
Potri.005G071300 58 / 2e-10 AT5G10380 135 / 1e-36 RING/U-box superfamily protein (.1)
Potri.002G006400 56 / 2e-10 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10015837 pacid=23163327 polypeptide=Lus10015837 locus=Lus10015837.g ID=Lus10015837.BGIv1.0 annot-version=v1.0
ATGTGGTGGCCGTGGTGGCAATATCTATACTTCACGCTTCCATGCCTAATTGCCTTCCTCGCCGTGCTATACATTCTCCGCGACCGTATAATCAACGGCG
GCAGCCAGACTCCTCCGCCGACGGTTCAGGGGAAAGGCACCACCACTACTACTGCTACTACTAGTACTAGTACTGACCTTCCGGGAAAGGTGATAAAGTA
TTACTCTAAAGAAGACGGCGGATGTGCGATATGCTTGGAGGAATGGGAAGAAGGAGACGAGTGCAGAGTGCTGCCGGAGTGCAACCACGTTTACCATAAG
GTTTGCGTTGACGGCTGGCTGTTGACAGGGGTCAACGAGCATCGTGATGATCAGTACCGTCGTTGCCCGACTTGCCGCCGTTTTGTTTTTGAGTCCGTTG
TGTGA
AA sequence
>Lus10015837 pacid=23163327 polypeptide=Lus10015837 locus=Lus10015837.g ID=Lus10015837.BGIv1.0 annot-version=v1.0
MWWPWWQYLYFTLPCLIAFLAVLYILRDRIINGGSQTPPPTVQGKGTTTTTATTSTSTDLPGKVIKYYSKEDGGCAICLEEWEEGDECRVLPECNHVYHK
VCVDGWLLTGVNEHRDDQYRRCPTCRRFVFESVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20823 RING/U-box superfamily protein... Lus10015837 0 1
AT5G46230 Protein of unknown function, D... Lus10000616 10.1 0.7473
AT3G52770 ZPR3 LITTLE ZIPPER 3, protein bindi... Lus10022725 17.3 0.6903
AT5G67150 HXXXD-type acyl-transferase fa... Lus10041591 21.1 0.6735
AT5G17820 Peroxidase superfamily protein... Lus10005681 22.3 0.6634
AT4G14010 RALFL32 ralf-like 32 (.1) Lus10008885 43.2 0.6251
AT3G59840 unknown protein Lus10040110 54.9 0.6499
AT5G52020 AP2_ERF Integrase-type DNA-binding sup... Lus10031656 65.3 0.6206
AT5G47430 DWNN domain, a CCHC-type zinc ... Lus10029205 76.9 0.6148
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Lus10015705 94.7 0.5971
AT1G04360 RING/U-box superfamily protein... Lus10024881 134.9 0.5701

Lus10015837 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.