Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01970 110 / 7e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G19520 80 / 9e-19 NFD5 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) AT5G16640 52 / 5e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G50280 49 / 1e-07 EMB1006 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64580 46 / 1e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G19890 45 / 1e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT2G35130 45 / 2e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G06430 44 / 4e-06 AtPPR2, EMB2750 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63630 42 / 7e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G63230 43 / 1e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009299 [exp] 154 / 3e-47 AT1G01970 430 / 1e-150 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030026 [exp] 81 / 1e-18 AT1G19520 660 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) Lus10035298 [exp] 79 / 3e-18 AT1G19520 658 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) Lus10000428 [exp] 54 / 1e-09 AT4G19890 407 / 1e-138 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10006083 [exp] 54 / 1e-09 AT4G19890 844 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10042081 [exp] 49 / 1e-07 AT5G50280 648 / 0.0 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022290 [exp] 48 / 2e-07 AT2G31400 911 / 0.0 genomes uncoupled 1 (.1) Lus10003657 [exp] 45 / 2e-06 AT2G31400 902 / 0.0 genomes uncoupled 1 (.1) Lus10023863 [exp] 45 / 2e-06 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G070500 [exp] 107 / 1e-28 AT1G01970 469 / 7e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G228200 [exp] 89 / 1e-21 AT1G19520 649 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) Potri.002G034900 [exp] 69 / 1e-14 AT1G19520 296 / 2e-93 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) Potri.015G121700 [exp] 51 / 2e-08 AT4G19890 923 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.013G058900 [exp] 45 / 2e-06 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G078900 [exp] 45 / 2e-06 AT3G23020 1046 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G091800 [exp] 44 / 3e-06 AT5G50280 845 / 0.0 embryo defective 1006, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G193900 [exp] 43 / 9e-06 AT2G31400 1192 / 0.0 genomes uncoupled 1 (.1) Potri.012G123600 [exp] 42 / 3e-05 AT2G35130 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G074000 [exp] 42 / 3e-05 AT4G39952 892 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10015864 pacid=23163311 polypeptide=Lus10015864 locus=Lus10015864.g ID=Lus10015864.BGIv1.0 annot-version=v1.0 ATGACTAAACAGTTTTTAGATCAGACTGATAGAGTAAAAGACTTTGATCTGTCTGACAAATTCTTCCCCTTGGGTTCAATGCTTGTTTATCAGGTGGCAA AATTTGCTTTACCGGAAGAATCTTTCGAGGCGAATATCCGGGACTATACAAAGCTAATCCACTACTATGCGAAGAAACACCAGCTCGAAGATGCCGAAAG GATCTTCTTATCAATGAAGGAAAGAGGCTTAGTTTACGATCAAGTAACAGTGACAGCCATGGTTCACATGTACAGCAAGGCAGGCTACCACAATAAGGCT GAGGAAGCATTCTGCCGGCTCGCTCTGCTGGGCTAG
AA sequence Show only first row Show all	>Lus10015864 pacid=23163311 polypeptide=Lus10015864 locus=Lus10015864.g ID=Lus10015864.BGIv1.0 annot-version=v1.0 MTKQFLDQTDRVKDFDLSDKFFPLGSMLVYQVAKFALPEESFEANIRDYTKLIHYYAKKHQLEDAERIFLSMKERGLVYDQVTVTAMVHMYSKAGYHNKA EEAFCRLALLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015864 [exp]	0	1
AT1G09620			ATP binding;leucine-tRNA ligas...		Lus10025653 [exp]	1.0	0.8654
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012472 [exp]	2.0	0.8218
AT5G22040			unknown protein		Lus10000457 [exp]	5.7	0.8060
AT5G11630			unknown protein		Lus10011623 [exp]	8.3	0.7264
AT4G13990			Exostosin family protein (.1)		Lus10007037 [exp]	12.5	0.7937
AT5G22280			unknown protein		Lus10034182 [exp]	20.2	0.7547
AT5G62440			Protein of unknown function (D...		Lus10023594 [exp]	21.2	0.7761
AT5G41950			Tetratricopeptide repeat (TPR)...		Lus10018184 [exp]	26.2	0.7718
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10033706 [exp]	26.8	0.7725
AT3G06430		AtPPR2, EMB2750	pentatricopeptide repeat 2, em...		Lus10039311 [exp]	30.5	0.7397

Compare expression of checked genes

Lus10015864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.