Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01970 97 / 1e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G19520 61 / 3e-12 NFD5 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009299 [exp] 136 / 1e-40 AT1G01970 430 / 1e-150 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030026 [exp] 42 / 9e-06 AT1G19520 660 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) Lus10035298 [exp] 42 / 9e-06 AT1G19520 658 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G070500 [exp] 102 / 3e-27 AT1G01970 469 / 7e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G228200 [exp] 45 / 9e-07 AT1G19520 649 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015865 pacid=23163259 polypeptide=Lus10015865 locus=Lus10015865.g ID=Lus10015865.BGIv1.0 annot-version=v1.0 ATGAGGAGGGCTGGTATCGAACCAAGTGATAAGTGTGTGGCTTTGGTTCTGGGTGCGTACGAGAAGGAGGAGAAGCTGAACCGGGCGTTGGAGTTTCTTG CGGGTTTGGAAAGAGATGGAGTTATGGTTGGGAAAGAAGCTTCGGCTATATTAGCTGGATGGTTCGGAAAGTTGGGAGTTTTGAAAGAAGTAGAGAGAGT ACTAAGTGAATATGAAAATTCCTACTCCAAGAGTTCTTCTGTGTTGCGATGA
AA sequence Show only first row Show all	>Lus10015865 pacid=23163259 polypeptide=Lus10015865 locus=Lus10015865.g ID=Lus10015865.BGIv1.0 annot-version=v1.0 MRRAGIEPSDKCVALVLGAYEKEEKLNRALEFLAGLERDGVMVGKEASAILAGWFGKLGVLKEVERVLSEYENSYSKSSSVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	0	1
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10009746 [exp]	2.8	0.6070
AT2G48060			unknown protein		Lus10035352 [exp]	3.5	0.6746
AT3G53170			Tetratricopeptide repeat (TPR)...		Lus10024144 [exp]	4.6	0.6832
					Lus10005512 [exp]	6.9	0.6399
AT5G59200		OTP80	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10010853 [exp]	9.7	0.5986
AT1G19880			Regulator of chromosome conden...		Lus10010614 [exp]	15.9	0.5682
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004602 [exp]	19.1	0.5671
AT1G24190		SNL3, AtSin3	ARABIDOPSIS THALIANA SIN3 HOMO...		Lus10022887 [exp]	26.6	0.5840
					Lus10011276 [exp]	29.2	0.5836
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10032323 [exp]	35.8	0.5577

Compare expression of checked genes

Lus10015865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.