Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12390 128 / 2e-39 Cornichon family protein (.1) AT1G12340 127 / 2e-39 Cornichon family protein (.1) AT1G62880 116 / 1e-34 Cornichon family protein (.1.2) AT4G12090 111 / 8e-33 Cornichon family protein (.1) AT3G12180 89 / 4e-24 Cornichon family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009295 [exp] 201 / 2e-68 AT1G12390 142 / 7e-45 Cornichon family protein (.1) Lus10028906 [exp] 127 / 3e-39 AT1G12390 207 / 2e-70 Cornichon family protein (.1) Lus10004320 [exp] 127 / 5e-38 AT1G12390 173 / 1e-55 Cornichon family protein (.1) Lus10007000 [exp] 113 / 3e-33 AT1G12390 176 / 3e-57 Cornichon family protein (.1) Lus10006997 [exp] 113 / 3e-33 AT1G12390 176 / 3e-57 Cornichon family protein (.1) Lus10030270 [exp] 110 / 6e-33 AT1G12390 94 / 2e-26 Cornichon family protein (.1) Lus10000384 [exp] 102 / 3e-29 AT1G12390 161 / 5e-52 Cornichon family protein (.1) Lus10004023 [exp] 0 / 1 AT1G12340 101 / 5e-30 Cornichon family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G116100 [exp] 131 / 8e-41 AT1G12390 184 / 3e-61 Cornichon family protein (.1) Potri.003G116400 [exp] 127 / 2e-39 AT1G12390 182 / 2e-60 Cornichon family protein (.1) Potri.002G148500 [exp] 87 / 1e-23 AT1G12390 106 / 9e-31 Cornichon family protein (.1) Potri.006G057300 [exp] 84 / 7e-22 AT3G12180 109 / 3e-31 Cornichon family protein (.1) Potri.016G051000 [exp] 83 / 1e-21 AT3G12180 142 / 4e-44 Cornichon family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03311 [flax] [poplar] Cornichon Cornichon protein
Representative CDS sequence Show only first row Show all	>Lus10015866 pacid=23163325 polypeptide=Lus10015866 locus=Lus10015866.g ID=Lus10015866.BGIv1.0 annot-version=v1.0 ATGTGCCTTTCGGATCTGGAGTTCGATTACGTAAACCCTTACGATTCGGCACGCAGAATAAATTCTGTGGTGTTGCCAGAGTACATCACTCATGCGGCGT TGAGCTTGTCCTTTCTACTGACCGGTCACTGGTTCCTCTGTTTACTATCATTGCCTTGCCTATACTATGATCTCACATTGTACTTGCAAAGGAAGCACTT GGTTGACGTTACAGAGATATATAACTACAACCGGCTGCATAGAGAGAAAAACCGAAGGCTTATTAAGATGGGATATGTCTTGATCATCCTAGTCTTTTCT TTGTTTTGGTAA
AA sequence Show only first row Show all	>Lus10015866 pacid=23163325 polypeptide=Lus10015866 locus=Lus10015866.g ID=Lus10015866.BGIv1.0 annot-version=v1.0 MCLSDLEFDYVNPYDSARRINSVVLPEYITHAALSLSFLLTGHWFLCLLSLPCLYYDLTLYLQRKHLVDVTEIYNYNRLHREKNRRLIKMGYVLIILVFS LFW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12390			Cornichon family protein (.1)		Lus10015866 [exp]	0	1
AT3G12770		MEF22	mitochondrial editing factor ...		Lus10024876 [exp]	3.5	0.8346
AT5G27830			unknown protein		Lus10020660 [exp]	3.6	0.8780
AT5G12240			unknown protein		Lus10026824 [exp]	4.9	0.8681
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10025201 [exp]	11.2	0.8267
AT5G51510			unknown protein		Lus10027200 [exp]	15.2	0.8335
AT1G36730			Translation initiation factor ...		Lus10010980 [exp]	19.7	0.8101
AT2G23940			Protein of unknown function (D...		Lus10028450 [exp]	20.4	0.8317
AT5G35730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10031575 [exp]	20.8	0.8066
AT2G25310			Protein of unknown function (D...		Lus10001955 [exp]	22.0	0.8309
AT4G35980			unknown protein		Lus10041889 [exp]	22.0	0.8196

Compare expression of checked genes

Lus10015866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.