Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60820 379 / 2e-135 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G21720 82 / 3e-19 PBC1 proteasome beta subunit C1 (.1) AT1G77440 81 / 1e-18 PBC2 20S proteasome beta subunit C2 (.1.2) AT4G31300 67 / 3e-13 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G56450 42 / 9e-05 PBG1 20S proteasome beta subunit G1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009294 [exp] 368 / 2e-122 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1) Lus10000062 [exp] 282 / 2e-98 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10004024 [exp] 189 / 2e-60 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030272 [exp] 93 / 8e-25 AT3G60820 81 / 2e-20 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030271 [exp] 90 / 1e-23 AT3G60820 82 / 3e-21 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10020599 [exp] 79 / 7e-18 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1) Lus10004885 [exp] 77 / 2e-17 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1) Lus10020180 [exp] 61 / 6e-11 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 51 / 2e-07 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G148300 [exp] 394 / 1e-141 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.014G069800 [exp] 388 / 6e-139 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G080800 [exp] 96 / 1e-24 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1) Potri.005G180500 [exp] 95 / 4e-24 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1) Potri.006G077900 [exp] 66 / 6e-13 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G145900 [exp] 66 / 8e-13 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10015867 pacid=23163296 polypeptide=Lus10015867 locus=Lus10015867.g ID=Lus10015867.BGIv1.0 annot-version=v1.0 ATGGCGCGATTTTCTCCCTATGACAACAATGGAGGCACATGTGTGGCGATTGCCGGTGCGGATTACTGTGTCATTGCTTCTGATACTCGGATGTCCACCG GCTACAATATTCTCACCCGTGATCACTCCAAAATCTACAAGCTAGCAGACAAATGTATATTAGCTTCTTCGGGATTTCAAGCTGATATGAAGGCTTTGCA GAAGCATTTGTCTGCCAGACACCTTATTTATCAGCATCAACATAACAAACAAATGAGCTGTTCTGCTATGGGTCAACTACTCTCTAACACCCTCTACTAC AAACGTTTCTTCCCTTACTACACCTTTAATATTCTGGGTGGCCTCGACAATGAAGGCAAGGGATGTGTTTACACGTATGATGCTGTTGGTTCCTATGAGA TGGTGGGGTACAGCTCCCAGGGTTCTGGTTCTAAACTGATCATGCCTTTCCTTGACAACCAGTTGAAGTCTCCAAGCCCTCTATTAGAGCCAGCGCAGGA TGCTGTGACTCCACTTTCTGAGTCTGAAGCAATTGATTTAGTGAAAACTTGTTTTGCTTCTGCAACCGAGAGGGACATACACACTGGAGACAAGCTTGAA ATAGTTGTGCTCAATGGTGATGGCATTCGTCGTGAATTTATGGAGTTGAGAAAGGACTAG
AA sequence Show only first row Show all	>Lus10015867 pacid=23163296 polypeptide=Lus10015867 locus=Lus10015867.g ID=Lus10015867.BGIv1.0 annot-version=v1.0 MARFSPYDNNGGTCVAIAGADYCVIASDTRMSTGYNILTRDHSKIYKLADKCILASSGFQADMKALQKHLSARHLIYQHQHNKQMSCSAMGQLLSNTLYY KRFFPYYTFNILGGLDNEGKGCVYTYDAVGSYEMVGYSSQGSGSKLIMPFLDNQLKSPSPLLEPAQDAVTPLSESEAIDLVKTCFASATERDIHTGDKLE IVVLNGDGIRREFMELRKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Lus10015867 [exp]	0	1
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10037416 [exp]	1.4	0.9319
AT5G20500			Glutaredoxin family protein (....		Lus10017148 [exp]	1.4	0.9413
AT5G16950			unknown protein		Lus10021093 [exp]	2.2	0.9186
AT5G17250			Alkaline-phosphatase-like fami...		Lus10006806 [exp]	3.5	0.9032
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10023492 [exp]	3.5	0.9200
AT3G04830			Protein prenylyltransferase su...		Lus10001785 [exp]	5.2	0.9201
AT3G12760			unknown protein		Lus10000875 [exp]	9.9	0.8845
AT5G13050		5-FCL	5-formyltetrahydrofolate cyclo...		Lus10004254 [exp]	12.1	0.8802
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10040374 [exp]	12.8	0.8886
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10014198 [exp]	13.2	0.8768

Compare expression of checked genes

Lus10015867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.