Lus10015869 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48120 42 / 0.0001 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016306 283 / 2e-98 ND /
Lus10003026 272 / 2e-93 AT2G25010 45 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10003952 257 / 6e-89 ND /
Lus10008850 252 / 7e-87 AT1G48120 39 / 8e-04 hydrolases;protein serine/threonine phosphatases (.1)
Lus10010397 182 / 6e-60 ND /
Lus10008153 174 / 8e-57 ND /
Lus10017027 183 / 5e-56 AT1G57790 286 / 6e-93 F-box family protein (.1)
Lus10006285 166 / 6e-54 ND /
Lus10014871 161 / 9e-52 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10015869 pacid=23163286 polypeptide=Lus10015869 locus=Lus10015869.g ID=Lus10015869.BGIv1.0 annot-version=v1.0
ATGACACATGCACATTTGGATTGGCCTCTGTTCACCCCTACTCCAGATGACGGTGATACCCTACGATCGTGCTATTTTGGAGGGATACACACGTTTGACA
TCATTGAGCCGCATGATCCCGTTCGTGTCCTTCGTCAGTACGGGTACCTGCAGGTGATTCCCCATCCACCTTTGACGCCAGAGGTTGTTGTCAGGCCTGC
TGATGGAGTCCTGTATGATGTGCGCCACTCAAGGTGTAATTTTAGCCACCTTGGTGCTTTGGCATACATGTCGAAGATTATCATACCTAGTGTACCGCGT
GTACCCGAAGGGAATGTGTTTCCCGATTACCTTGCGTGGTATCTCGACCGCACACATCCATATATCACCCCGTCACTCACGACAGATGATCCCCCAGTTT
CTGAGTTTCTGGCACGGGCTATTTCCGACCGCATTGTCCACGGATTGGCGCCCCTTTGGGAAGTCGATACTGTAGAGGCTTTCGTTGACAGAGGACCAAC
GTACTTCGGGTGGGTTTAG
AA sequence
>Lus10015869 pacid=23163286 polypeptide=Lus10015869 locus=Lus10015869.g ID=Lus10015869.BGIv1.0 annot-version=v1.0
MTHAHLDWPLFTPTPDDGDTLRSCYFGGIHTFDIIEPHDPVRVLRQYGYLQVIPHPPLTPEVVVRPADGVLYDVRHSRCNFSHLGALAYMSKIIIPSVPR
VPEGNVFPDYLAWYLDRTHPYITPSLTTDDPPVSEFLARAISDRIVHGLAPLWEVDTVEAFVDRGPTYFGWV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48120 hydrolases;protein serine/thre... Lus10015869 0 1
Lus10021782 2.2 1.0000
Lus10023587 4.2 1.0000
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 4.9 1.0000
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 5.2 1.0000
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 6.0 1.0000
AT3G19540 Protein of unknown function (D... Lus10028040 6.7 1.0000
AT2G34320 Polynucleotidyl transferase, r... Lus10039942 7.9 1.0000
Lus10007927 7.9 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10016922 8.4 1.0000
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10039026 8.5 1.0000

Lus10015869 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.