Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45330 99 / 3e-27 TRPT, EMB1067 2' tRNA phosphotransferase, embryo defective 1067, RNA 2'-phosphotransferase, Tpt1 / KptA family (.1.2) AT5G23600 88 / 1e-23 RNA 2'-phosphotransferase, Tpt1 / KptA family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009289 [exp] 122 / 1e-36 AT2G45330 333 / 3e-116 2' tRNA phosphotransferase, embryo defective 1067, RNA 2'-phosphotransferase, Tpt1 / KptA family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G117000 [exp] 109 / 2e-31 AT2G45330 310 / 3e-106 2' tRNA phosphotransferase, embryo defective 1067, RNA 2'-phosphotransferase, Tpt1 / KptA family (.1.2) Potri.013G094500 [exp] 107 / 2e-30 AT2G45330 312 / 6e-107 2' tRNA phosphotransferase, embryo defective 1067, RNA 2'-phosphotransferase, Tpt1 / KptA family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0084 [flax] [poplar] ADP-ribosyl PF01885 [flax] [poplar] PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Representative CDS sequence Show only first row Show all	>Lus10015875 pacid=23163323 polypeptide=Lus10015875 locus=Lus10015875.g ID=Lus10015875.BGIv1.0 annot-version=v1.0 ATGAGAAAGAACATAAATGTCGTTATTTTCCTGGATGTGAAAAAGGCACTTGAAGATGGAATGAAGCTGTACGTATCGGAGAATAAGGTGATATTGACTG AAGGTTTCGATGGTGTTGTGCCGGTGAAGTACTTTGAGAAAGTTGAATGTTGGCCTAGTCGAAGACCTATCCCATTACAAAGCTAA
AA sequence Show only first row Show all	>Lus10015875 pacid=23163323 polypeptide=Lus10015875 locus=Lus10015875.g ID=Lus10015875.BGIv1.0 annot-version=v1.0 MRKNINVVIFLDVKKALEDGMKLYVSENKVILTEGFDGVVPVKYFEKVECWPSRRPIPLQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45330		TRPT, EMB1067	2' tRNA phosphotransferase, em...		Lus10015875 [exp]	0	1
AT1G21550			Calcium-binding EF-hand family...		Lus10029730 [exp]	6.7	0.6125
AT3G25710	bHLH	TMO5, BHLH32, b...	TARGET OF MONOPTEROS 5, basic ...		Lus10036175 [exp]	8.1	0.7093
AT3G18240			Ribosomal protein S24/S35, mit...		Lus10012470 [exp]	18.7	0.5609
					Lus10002306 [exp]	22.5	0.6396
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Lus10034397 [exp]	28.7	0.5980
AT2G17580			Polynucleotide adenylyltransfe...		Lus10035995 [exp]	60.4	0.5764
AT1G48570			zinc finger (Ran-binding) fami...		Lus10009681 [exp]	74.1	0.5191
					Lus10006725 [exp]	83.7	0.5663
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10041647 [exp]	96.4	0.5600
AT5G10260		AtRABH1e	RAB GTPase homolog H1E (.1)		Lus10014336 [exp]	113.7	0.5297

Compare expression of checked genes

Lus10015875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.