Lus10015879 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60690 149 / 4e-46 SAUR-like auxin-responsive protein family (.1)
AT2G45210 139 / 2e-42 SAUR-like auxin-responsive protein family (.1)
AT4G22620 111 / 2e-31 SAUR-like auxin-responsive protein family (.1)
AT4G12410 104 / 1e-28 SAUR-like auxin-responsive protein family (.1)
AT2G46690 79 / 4e-19 SAUR-like auxin-responsive protein family (.1)
AT5G53590 78 / 2e-18 SAUR-like auxin-responsive protein family (.1)
AT4G00880 77 / 2e-18 SAUR-like auxin-responsive protein family (.1)
AT3G61900 75 / 2e-17 SAUR-like auxin-responsive protein family (.1)
AT3G03850 72 / 7e-17 SAUR-like auxin-responsive protein family (.1)
AT2G21210 70 / 4e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009286 330 / 2e-117 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10030295 167 / 2e-53 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1)
Lus10001985 115 / 4e-33 AT2G45210 93 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Lus10024600 105 / 7e-29 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1)
Lus10032237 96 / 3e-25 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10004337 88 / 3e-22 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Lus10028920 86 / 6e-22 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1)
Lus10010110 72 / 3e-16 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10007561 69 / 3e-15 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G066900 201 / 2e-66 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1)
Potri.002G145300 191 / 2e-62 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1)
Potri.003G113100 121 / 4e-35 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1)
Potri.001G119900 115 / 5e-33 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 78 / 7e-19 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 78 / 8e-19 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 78 / 1e-18 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 74 / 4e-17 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 70 / 5e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127500 68 / 3e-15 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10015879 pacid=23163272 polypeptide=Lus10015879 locus=Lus10015879.g ID=Lus10015879.BGIv1.0 annot-version=v1.0
ATGAGAAGAATCAAGGGATTCAAGTTACGGAAGCGATTTCTCCGCGTCGCAACTTGGATCTTCACCCGCAGGCGGAGAAACTGCTCTCTCTACAATCGGT
TAGTTTCCGGGGACGACGGCTCAACGTCATCGTCACCGAGATACAAGCCGATTAGGAAAATCATCGACTGGGGCCGCCGATTGACCACCGGTGCGAAATC
GCTCTGCTCTGCCAAACCGGGTAATTACTTGCGGGTCGAAGAACAGAAGGAGCCGCTCTGCGAGAAAGCGGCGGCCGTGCCCAAGGGTCATCTGGCGGTT
TACGTGGGCGAAAAGGACGGCGGCGGCGGGGGCTGTCACAGAGTGTTCGTGCCGGTGATTTACGTAAACCATCCCCTGTTCGGCGATCTACTGAGGGAGG
CGGAGCAAGAGTACGGATTCAGCCAGGAAGGCGGGATAACGATTCCTTGTCCCTTCGCCGAGTTTGAACGTGTCAAGACGAGGATCGATGCCGGGACTTG
CGGCGGCCGGCGTCTGCATACGTGGAAACGCAATCACTATTGA
AA sequence
>Lus10015879 pacid=23163272 polypeptide=Lus10015879 locus=Lus10015879.g ID=Lus10015879.BGIv1.0 annot-version=v1.0
MRRIKGFKLRKRFLRVATWIFTRRRRNCSLYNRLVSGDDGSTSSSPRYKPIRKIIDWGRRLTTGAKSLCSAKPGNYLRVEEQKEPLCEKAAAVPKGHLAV
YVGEKDGGGGGCHRVFVPVIYVNHPLFGDLLREAEQEYGFSQEGGITIPCPFAEFERVKTRIDAGTCGGRRLHTWKRNHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60690 SAUR-like auxin-responsive pro... Lus10015879 0 1
AT3G60690 SAUR-like auxin-responsive pro... Lus10009286 1.4 0.9355
AT5G23230 NIC2 nicotinamidase 2 (.1) Lus10040988 3.3 0.8880
AT1G02840 ATSRP34, SR1, S... Serine/Arginine-Rich Protein S... Lus10020656 3.5 0.8876
AT3G58070 C2H2ZnF GIS GLABROUS INFLORESCENCE STEMS, ... Lus10016238 4.6 0.9209
AT1G61930 Protein of unknown function, D... Lus10020047 4.7 0.9230
Lus10038478 4.8 0.8747
AT1G28280 VQ motif-containing protein (.... Lus10041929 5.3 0.9172
AT5G53730 Late embryogenesis abundant (L... Lus10032932 5.9 0.9054
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Lus10022225 7.3 0.8933
AT5G40650 SDH2-2 succinate dehydrogenase 2-2 (.... Lus10014879 7.9 0.8674

Lus10015879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.