Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45200 123 / 4e-36 ATGOS12, GOS12 golgi snare 12 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009285 [exp] 130 / 1e-38 AT2G45200 444 / 2e-160 golgi snare 12 (.1.2) Lus10001986 [exp] 128 / 7e-38 AT2G45200 437 / 5e-158 golgi snare 12 (.1.2) Lus10030294 [exp] 86 / 2e-21 AT2G45200 297 / 2e-102 golgi snare 12 (.1.2) Lus10014349 [exp] 44 / 2e-06 AT1G15880 214 / 7e-72 golgi snare 11 (.1) Lus10026058 [exp] 44 / 3e-06 AT1G15880 288 / 4e-100 golgi snare 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G066800 [exp] 125 / 6e-37 AT2G45200 372 / 3e-132 golgi snare 12 (.1.2) Potri.002G145200 [exp] 124 / 1e-36 AT2G45200 365 / 3e-129 golgi snare 12 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015880 pacid=23163257 polypeptide=Lus10015880 locus=Lus10015880.g ID=Lus10015880.BGIv1.0 annot-version=v1.0 ATGAAGGAGCACGCTGAATTACTTGGTTCAGTTAGAGATGATATCAGCGAGTACAAGGCTTCAGGAAGCATGTCTCCAAGAATGCAATTATTACATGAAA GAGCTTCCATACATGGAAGCATTTCTCATATAATGTTATCAGTCAAGCTCAGGCAACCAGAGCAGTTTTGGCATCTCAAAGGTCCTTCTTTGGAGATGTA CAAGGGAGTGAAGCAACTAAGTGACAAATTCCCCATCATACGTGGTTTACTCGGTTCTATCAGGAGGCGGCGTTCTAGAGACACGCTTATACTCTCTGCT GTCGTTGCAGCTTGTTCCTTGTTCCTAATCATTTATTGGCTGTCCAAATGA
AA sequence Show only first row Show all	>Lus10015880 pacid=23163257 polypeptide=Lus10015880 locus=Lus10015880.g ID=Lus10015880.BGIv1.0 annot-version=v1.0 MKEHAELLGSVRDDISEYKASGSMSPRMQLLHERASIHGSISHIMLSVKLRQPEQFWHLKGPSLEMYKGVKQLSDKFPIIRGLLGSIRRRRSRDTLILSA VVAACSLFLIIYWLSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Lus10015880 [exp]	0	1
AT1G04410		c-NAD-MDH1	cytosolic-NAD-dependent malate...		Lus10021183 [exp]	3.5	1.0000
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10023221 [exp]	5.7	1.0000
					Lus10001326 [exp]	5.9	1.0000
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	7.3	1.0000
					Lus10026755 [exp]	10.2	1.0000
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10008511 [exp]	11.8	1.0000
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Lus10009470 [exp]	12.4	1.0000
AT2G43610			Chitinase family protein (.1)		Lus10020253 [exp]	13.4	1.0000
					Lus10026593 [exp]	13.6	1.0000
AT1G17260		AHA10	autoinhibited H\(+\)-ATPase is...		Lus10003924 [exp]	18.0	1.0000

Compare expression of checked genes

Lus10015880 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.