Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00165 131 / 2e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G45180 100 / 6e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 96 / 3e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 96 / 2e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 93 / 4e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 90 / 4e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 91 / 7e-24 AZI1 azelaic acid induced 1 (.1) AT4G12520 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 88 / 2e-23 AIR1 Auxin-Induced in Root cultures 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009282 [exp] 223 / 2e-76 AT4G00165 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032253 [exp] 100 / 4e-28 ND 139 / 2e-43 Lus10032254 [exp] 100 / 6e-28 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024627 [exp] 100 / 7e-28 AT4G12520 136 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024616 [exp] 100 / 9e-28 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 99 / 1e-27 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 100 / 2e-27 ND 139 / 6e-43 Lus10032263 [exp] 100 / 2e-27 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 96 / 4e-26 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G059800 [exp] 128 / 4e-39 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 104 / 2e-29 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 103 / 2e-29 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 101 / 2e-28 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 99 / 2e-27 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 97 / 1e-26 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 97 / 2e-26 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 94 / 2e-25 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 93 / 1e-23 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G200100 [exp] 76 / 9e-19 AT4G12470 69 / 8e-16 azelaic acid induced 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10015883 pacid=23163277 polypeptide=Lus10015883 locus=Lus10015883.g ID=Lus10015883.BGIv1.0 annot-version=v1.0 ATGGGGTTGTTCACGGGTTCCAAGGCAACCACCACCATAGCTCTTCTTCTTCTTGCTCTGTTTCTAACCTCTGTTTCGTCTCACGGAGTACCACCATGCC AACCAGCTGCAAAACCAAAACACACACTACCGGTGATACCTCCACCGCAGCCGACCACCTCCGACAAGTGCCCCAGGGACGTGCTGAAGTTCGGGGTTTG CGGGAGCTGGTTGGGCTTGGCGTACGAGGTTGTGGGGACTAAACCAAGCGAGGAATGCTGCACGGTCATCAAAGGGATTGTAGATCTGGAAGCAGCTATG TGTCTGTGCACTGCAATCAAAGCTAATGTTCTGGGAATGGTGAAGCTGGACATCCCCATCGCTGCTACTTTGCTCGTCAATGCCTGTGGTGGTGATATCC CACAAGGATTTAAGTGCGCTTGA
AA sequence Show only first row Show all	>Lus10015883 pacid=23163277 polypeptide=Lus10015883 locus=Lus10015883.g ID=Lus10015883.BGIv1.0 annot-version=v1.0 MGLFTGSKATTTIALLLLALFLTSVSSHGVPPCQPAAKPKHTLPVIPPPQPTTSDKCPRDVLKFGVCGSWLGLAYEVVGTKPSEECCTVIKGIVDLEAAM CLCTAIKANVLGMVKLDIPIAATLLVNACGGDIPQGFKCA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00165			Bifunctional inhibitor/lipid-t...		Lus10015883 [exp]	0	1
AT4G00165			Bifunctional inhibitor/lipid-t...		Lus10009282 [exp]	1.0	0.9556
AT2G27385			Pollen Ole e 1 allergen and ex...		Lus10004847 [exp]	2.8	0.9418
AT5G62360			Plant invertase/pectin methyle...		Lus10031138 [exp]	3.2	0.9493
AT2G27385			Pollen Ole e 1 allergen and ex...		Lus10020642 [exp]	3.2	0.9365
AT3G57930			unknown protein		Lus10031806 [exp]	3.5	0.9313
AT3G09870			SAUR-like auxin-responsive pro...		Lus10013819 [exp]	3.7	0.9265
AT1G60060			Serine/threonine-protein kinas...		Lus10018736 [exp]	4.2	0.9445
AT3G47570			Leucine-rich repeat protein ki...		Lus10037311 [exp]	5.5	0.9167
AT3G21880	CO	COL12	B-box type zinc finger protein...		Lus10031584 [exp]	6.3	0.8949
AT5G54010			UDP-Glycosyltransferase superf...		Lus10013337 [exp]	7.5	0.9254

Compare expression of checked genes

Lus10015883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.