Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09740 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 92 / 1e-23 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 72 / 5e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G47710 71 / 6e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 71 / 1e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 55 / 3e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT4G27320 53 / 2e-08 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 48 / 8e-07 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 43 / 2e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 42 / 3e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009272 [exp] 285 / 2e-99 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 84 / 5e-20 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 85 / 2e-19 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10041436 [exp] 76 / 2e-17 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 70 / 2e-15 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 69 / 1e-14 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10006701 [exp] 64 / 5e-13 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006703 [exp] 62 / 1e-12 AT2G47710 169 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 62 / 2e-12 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G104700 [exp] 234 / 1e-79 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G157100 [exp] 143 / 1e-44 AT1G09740 127 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 82 / 2e-19 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 79 / 7e-19 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 79 / 2e-18 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123200 [exp] 76 / 1e-17 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 72 / 7e-16 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 71 / 1e-15 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 69 / 7e-15 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 70 / 8e-15 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10015896 pacid=23163264 polypeptide=Lus10015896 locus=Lus10015896.g ID=Lus10015896.BGIv1.0 annot-version=v1.0 ATGTCTTCGACTTCCAACATCGGTTGCGCCGTCGTCGCCGTAGACGGCAGCGAGGAGAGCATGTATGCCTTGCGGTGGGCTCTTGACAACGTCAACCTCC GATCTCCTCCTGCCATCTCTACCGAATTGCCTGGATCATTCGTCATCCTCCACGTCCAATCGCCGCCGTCAATAGCTGTAGGCCTCAATCCTGGCGCCAT CCCCTTCGGCGGTCCAAGTGATCTGGAGGTTCCAGCTTTCACCGCGGCGATTGAGGCTCACCAGAAACGGATTACGGAAGCGATCGTTGACCACGCCTTG GAGATTTGCCGCAAAAAGAACCTTAACTGGAATACTGGCCAGGCTGCTATGAGAACGCAAGTGGTGATTGGGGACCCCAAAGAGAAGATATGTGAAATTG TAGAGAGTCTTCATGCTGATTTGTTGGTGATGGGCTCCCGAGACTTTGGTCCTATTAAAAGGGCAAAGGCGAGAACAAGGACACTTCCTCGTAGGGCTAC TAAAGTATGCATCTCCGGGTCCTCGCTTATCACCCAGTAG
AA sequence Show only first row Show all	>Lus10015896 pacid=23163264 polypeptide=Lus10015896 locus=Lus10015896.g ID=Lus10015896.BGIv1.0 annot-version=v1.0 MSSTSNIGCAVVAVDGSEESMYALRWALDNVNLRSPPAISTELPGSFVILHVQSPPSIAVGLNPGAIPFGGPSDLEVPAFTAAIEAHQKRITEAIVDHAL EICRKKNLNWNTGQAAMRTQVVIGDPKEKICEIVESLHADLLVMGSRDFGPIKRAKARTRTLPRRATKVCISGSSLITQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09740			Adenine nucleotide alpha hydro...		Lus10015896 [exp]	0	1
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10023266 [exp]	3.0	0.9631
AT1G65930		cICDH	cytosolic NADP+-dependent isoc...		Lus10020798 [exp]	3.7	0.9555
AT2G26060		EMB1345	embryo defective 1345, Transdu...		Lus10021365 [exp]	5.7	0.9488
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10019159 [exp]	5.8	0.9261
AT3G63010		ATGID1B, GID1B	GA INSENSITIVE DWARF1B, alpha/...		Lus10008189 [exp]	8.7	0.9441
AT1G11320			unknown protein		Lus10013574 [exp]	9.8	0.9393
AT3G19080			SWIB complex BAF60b domain-con...		Lus10009333 [exp]	10.0	0.9439
AT5G03700			D-mannose binding lectin prote...		Lus10023868 [exp]	11.0	0.9380
					Lus10027730 [exp]	12.6	0.9349
AT2G01140		PDE345	PIGMENT DEFECTIVE 345, Aldolas...		Lus10034619 [exp]	13.6	0.9415

Compare expression of checked genes

Lus10015896 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.