Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10810 59 / 2e-11 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60750 57 / 4e-11 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60680 57 / 1e-10 AGD2 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60710 56 / 1e-10 ATB2 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60690 55 / 4e-10 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60730 55 / 5e-10 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029615 [exp] 122 / 3e-35 AT1G60710 399 / 2e-139 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041184 [exp] 80 / 6e-19 AT1G60690 374 / 1e-129 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041185 [exp] 78 / 2e-18 AT1G60750 384 / 2e-133 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041303 [exp] 56 / 2e-10 AT1G60690 419 / 1e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10006105 [exp] 56 / 3e-10 AT1G60690 554 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10023701 [exp] 53 / 2e-09 AT1G60690 527 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037437 [exp] 52 / 5e-09 AT1G60690 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037408 [exp] 52 / 5e-09 AT1G60730 311 / 6e-106 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3) Lus10041272 [exp] 50 / 2e-08 AT1G60710 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G040000 [exp] 82 / 5e-20 AT1G60710 376 / 2e-130 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G052400 [exp] 82 / 8e-20 AT1G60680 395 / 1e-137 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.013G040100 [exp] 82 / 9e-20 AT1G60710 369 / 1e-127 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G158300 [exp] 77 / 4e-18 AT1G60680 389 / 2e-135 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.014G147700 [exp] 55 / 4e-10 AT1G60710 559 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234201 [exp] 55 / 4e-10 AT1G60710 547 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234000 [exp] 55 / 5e-10 AT1G60690 524 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10015917 pacid=23143790 polypeptide=Lus10015917 locus=Lus10015917.g ID=Lus10015917.BGIv1.0 annot-version=v1.0 ATGAGTGAGCTGAAGAAGCTGGTGGAAGAAGGGAAAACCAAGTACATTGGGTTGTCTGAGGCTAGTCCTAATACCATAAGGAGAGCACACGGGCATGATG TTGTACCTATTCCTGGTACCAGTAAAATTAAAAACCTGGAGGAAAACATTGGATCCTTAAAGGTGAAGCTTTCAGCAGAGGAACTTAAAGAGGTTACTGA TGTTGTACAACTTGAAGATGTGGCTGGCACTAGAACTTACCAAAGCATGATGAATCTATCATGGCCATTTGCTAATACACCTGTCAAGAATAATTAG
AA sequence Show only first row Show all	>Lus10015917 pacid=23143790 polypeptide=Lus10015917 locus=Lus10015917.g ID=Lus10015917.BGIv1.0 annot-version=v1.0 MSELKKLVEEGKTKYIGLSEASPNTIRRAHGHDVVPIPGTSKIKNLEENIGSLKVKLSAEELKEVTDVVQLEDVAGTRTYQSMMNLSWPFANTPVKNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60690			NAD(P)-linked oxidoreductase s...		Lus10015917 [exp]	0	1

Compare expression of checked genes

Lus10015917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.