Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49570 124 / 6e-34 ATPNG1 peptide-N-glycanase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009179 [exp] 154 / 2e-44 AT5G49570 817 / 0.0 peptide-N-glycanase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G039600 [exp] 141 / 3e-40 AT5G49570 834 / 0.0 peptide-N-glycanase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015918 pacid=23143794 polypeptide=Lus10015918 locus=Lus10015918.g ID=Lus10015918.BGIv1.0 annot-version=v1.0 ATGGAGTCTGTGATGTCACAAAACGTTACACTACAAAGTGGCCAGAGGTGGGTGGAATTGTATAGTATTAAAGACGGCGAGAAGTGTGAACTAGAAGCTT ATGAGATCACATCAGCTAATGATGCTCCAGAGAGGGATCCAAAGGAATGGGTTGTTGAAGGGAGCGATGACGGTGGATCCAGCTGGCATATCTTGGATAG GCAAACTTCGGAGTTGTTCGAAGATCGGTTTCAGTGTAGATCTTTTGAAGTTAGATTGAAAGGTCTGCCATGCAATGCCTTCAGGTTCCATTTCCTGGCT GCAAGAGATATCGAATCCAATTCTCGGCTGCAACTGTGTAGGATTAACCTGTACACTAATAGCAAATGA
AA sequence Show only first row Show all	>Lus10015918 pacid=23143794 polypeptide=Lus10015918 locus=Lus10015918.g ID=Lus10015918.BGIv1.0 annot-version=v1.0 MESVMSQNVTLQSGQRWVELYSIKDGEKCELEAYEITSANDAPERDPKEWVVEGSDDGGSSWHILDRQTSELFEDRFQCRSFEVRLKGLPCNAFRFHFLA ARDIESNSRLQLCRINLYTNSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49570		ATPNG1	peptide-N-glycanase 1 (.1)		Lus10015918 [exp]	0	1
AT2G23460		ATXLG1, XLG1	extra-large G-protein 1 (.1)		Lus10021012 [exp]	2.4	0.8836
AT5G35180			Protein of unknown function (D...		Lus10019068 [exp]	5.2	0.8476
AT4G00290			Mechanosensitive ion channel p...		Lus10005121 [exp]	5.6	0.8456
AT2G45990			unknown protein		Lus10036369 [exp]	6.9	0.8810
AT4G17070			peptidyl-prolyl cis-trans isom...		Lus10036745 [exp]	9.5	0.8598
AT5G22620			phosphoglycerate/bisphosphogly...		Lus10009404 [exp]	9.8	0.8620
AT4G33060			Cyclophilin-like peptidyl-prol...		Lus10026441 [exp]	10.4	0.8773
AT4G02210			unknown protein		Lus10042596 [exp]	12.5	0.8492
AT1G16670			Protein kinase superfamily pro...		Lus10042851 [exp]	12.5	0.8842
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10031458 [exp]	12.8	0.8404

Compare expression of checked genes

Lus10015918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.