Plant FIBer expression Database

Lus10015922 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17530 40 / 2e-05 ATTIM23-1 translocase of inner mitochondrial membrane 23 (.1)
AT1G72750 40 / 3e-05 ATTIM23-2 translocase inner membrane subunit 23-2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009183
[exp]
66 / 3e-15 AT1G17530 198 / 4e-65 translocase of inner mitochondrial membrane 23 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G051800
[exp]
58 / 4e-12 AT3G04800 187 / 4e-61 translocase inner membrane subunit 23-3 (.1)
Potri.013G039200
[exp]
58 / 4e-12 AT3G04800 190 / 5e-62 translocase inner membrane subunit 23-3 (.1)
Potri.001G198100
[exp]
40 / 1e-05 AT1G17530 154 / 6e-48 translocase of inner mitochondrial membrane 23 (.1)
Potri.003G044100
[exp]
37 / 0.0004 AT1G17530 179 / 9e-58 translocase of inner mitochondrial membrane 23 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10015922 pacid=23143772 polypeptide=Lus10015922 locus=Lus10015922.g ID=Lus10015922.BGIv1.0 annot-version=v1.0
ATGTTTACTGGGATCGAGAGCAGCTTGATAGCTTTGAGGGACACGGATGACTTGGTGAACACCGTTGTTCCCGGGCTTGGCACTGGGGCAGTTTATCGAG
CAGGTAGAGGGCCTAGATCTGCTGCAATTGCTGGCGCCATTGGAGGAATTGCTGCGGCCGCTGCTGTGGCTGGGAAGCAGGCTGTCAAGAGATATGTTCT
TGTGTAG
AA sequence
>Lus10015922 pacid=23143772 polypeptide=Lus10015922 locus=Lus10015922.g ID=Lus10015922.BGIv1.0 annot-version=v1.0
MFTGIESSLIALRDTDDLVNTVVPGLGTGAVYRAGRGPRSAAIAGAIGGIAAAAAVAGKQAVKRYVLV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10015922
[exp]
0 1
AT3G16240 DELTA-TIP1, ATT... delta tonoplast integral prote... Lus10038293
[exp]
8.5 0.7506
AT4G21320 HSA32 HEAT-STRESS-ASSOCIATED 32, Ald... Lus10007625
[exp]
14.2 0.7611
AT2G22170 Lipase/lipooxygenase, PLAT/LH2... Lus10006497
[exp]
16.6 0.7352
AT3G13130 unknown protein Lus10038793
[exp]
19.9 0.7514
AT3G13440 S-adenosyl-L-methionine-depend... Lus10008072
[exp]
22.2 0.6401
AT4G17600 LIL3:1 Chlorophyll A-B binding family... Lus10001008
[exp]
27.0 0.7402
AT4G16450 unknown protein Lus10038803
[exp]
29.0 0.7316
AT5G64660 ATCMPG2 "CYS, MET, PRO, and GLY protei... Lus10005810
[exp]
30.7 0.7191
AT3G25580 Thioredoxin superfamily protei... Lus10026602
[exp]
36.7 0.7174
AT2G05320 beta-1,2-N-acetylglucosaminylt... Lus10001174
[exp]
38.2 0.7411

Lus10015922 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.