Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04880 159 / 3e-49 DRT102 DNA-DAMAGE-REPAIR/TOLERATION 2, DNA-damage-repair/toleration protein (DRT102) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G050600 [exp] 179 / 7e-57 AT3G04880 431 / 7e-153 DNA-DAMAGE-REPAIR/TOLERATION 2, DNA-damage-repair/toleration protein (DRT102) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015936 pacid=23143777 polypeptide=Lus10015936 locus=Lus10015936.g ID=Lus10015936.BGIv1.0 annot-version=v1.0 ATGAAGATTGTGAGAGAGAGTCCAACATCGGCAATCGTGACCTTCAAAGCCGGGAGCGGGGAACCGGCACACCACCACACTTTTGGACACGATTTGCTCG TGATGAAAGATAACAAGTGGGTGTGGAACATGATGAAGATGGAGAAATATGATCTGGTAGCCGAAGATTATCTGTTCACTCCGGCGGGAGACGTGCACAA GGCGAAGTATTTTCAAGAGACGGAATTCTTCATCAAGTGGGAAGGGAAATGGGACATTTTCTTCGATGAAGAGATGGACGCTGCCAAGTTCGCTATTGAG AAAGAAGCGAAACATTGCAACGAGAATCTTAATGTTGGTCCCGGTTAA
AA sequence Show only first row Show all	>Lus10015936 pacid=23143777 polypeptide=Lus10015936 locus=Lus10015936.g ID=Lus10015936.BGIv1.0 annot-version=v1.0 MKIVRESPTSAIVTFKAGSGEPAHHHTFGHDLLVMKDNKWVWNMMKMEKYDLVAEDYLFTPAGDVHKAKYFQETEFFIKWEGKWDIFFDEEMDAAKFAIE KEAKHCNENLNVGPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04880		DRT102	DNA-DAMAGE-REPAIR/TOLERATION 2...		Lus10015936 [exp]	0	1
AT3G60160		ATMRP9, ABCC9	ATP-binding cassette C9, multi...		Lus10018027 [exp]	1.0	0.8680
AT2G47890	CO	COL13	B-box type zinc finger protein...		Lus10005936 [exp]	5.5	0.8366
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Lus10036674 [exp]	8.5	0.8580
AT5G18130			unknown protein		Lus10020284 [exp]	8.5	0.7996
					Lus10018215 [exp]	9.2	0.8445
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10032585 [exp]	13.7	0.8422
AT1G15760			Sterile alpha motif (SAM) doma...		Lus10041687 [exp]	14.5	0.7969
AT5G48670	MADS	FEM111, AGL80	AGAMOUS-like 80 (.1)		Lus10022316 [exp]	19.1	0.8069
					Lus10003132 [exp]	19.1	0.8323
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Lus10041390 [exp]	19.8	0.8127

Compare expression of checked genes

Lus10015936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.